Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 849217..849842 | Replicon | chromosome |
| Accession | NZ_CP100715 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R17.5474 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | M7SD17 |
| Locus tag | NL730_RS04105 | Protein ID | WP_000911336.1 |
| Coordinates | 849444..849842 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | NL730_RS04100 | Protein ID | WP_000557549.1 |
| Coordinates | 849217..849444 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL730_RS04070 (844262) | 844262..845779 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| NL730_RS04075 (845855) | 845855..846400 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
| NL730_RS04080 (846665) | 846665..847423 | + | 759 | WP_000244329.1 | amidase activator ActS | - |
| NL730_RS04090 (847708) | 847708..848514 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
| NL730_RS04095 (848789) | 848789..849040 | - | 252 | WP_001540858.1 | hypothetical protein | - |
| NL730_RS04100 (849217) | 849217..849444 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NL730_RS04105 (849444) | 849444..849842 | + | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| NL730_RS04110 (850648) | 850648..851184 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
| NL730_RS04115 (851231) | 851231..851863 | + | 633 | WP_000835265.1 | YfdX family protein | - |
| NL730_RS04120 (852582) | 852582..853166 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 847708..859033 | 11325 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T251177 WP_000911336.1 NZ_CP100715:849444-849842 [Salmonella enterica subsp. enterica serovar Typhimurium]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFC | |
| PDB | 6IFM |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFM | |
| AlphaFold DB | A0A3V2Y5V5 |