Detailed information of TA system TA251133

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 1028068..1028882
• Replicon: chromosome
• Accession: NZ_CP100707
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium strain R18.0409

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: NL735_RS04950
• Protein ID: WP_000971655.1
• Coordinates: 1028068..1028595 (-)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: E8XL32
• Locus tag: NL735_RS04955
• Protein ID: WP_000855692.1
• Coordinates: 1028592..1028882 (-)
• Length: 97 a.a.

Genomic Context

Location: 1026094..1026615 (522 bp)
Type: Others
Protein ID: WP_000858988.1

Location: 1027790..1027995 (206 bp)
Type: Others
Protein ID: Protein_970

Location: 1029571..1029897 (327 bp)
Type: Others
Protein ID: WP_000393302.1

Location: 1032282..1032932 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 1023368..1025935 (2568 bp)
Type: Others
Protein ID: WP_001005807.1

Location: 1026787..1027443 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 1028068..1028595 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 1028592..1028882 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1

Location: 1029152..1029330 (179 bp)
Type: Others
Protein ID: Protein_973

Location: 1030170..1030517 (348 bp)
Type: Others
Protein ID: WP_001669174.1

Location: 1030502..1030951 (450 bp)
Type: Others
Protein ID: WP_000381610.1

Location: 1031382..1031825 (444 bp)
Type: Others
Protein ID: WP_000715092.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NL735_RS04930 (1023368)	1023368..1025935	-	2568	WP_001005807.1	DNA mismatch repair protein MutS	-
NL735_RS04935 (1026094)	1026094..1026615	+	522	WP_000858988.1	hypothetical protein	-
NL735_RS04940 (1026787)	1026787..1027443	-	657	WP_000420452.1	protein-serine/threonine phosphatase	-
NL735_RS04945 (1027790)	1027790..1027995	+	206	Protein_970	IS5/IS1182 family transposase	-
NL735_RS04950 (1028068)	1028068..1028595	-	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
NL735_RS04955 (1028592)	1028592..1028882	-	291	WP_000855692.1	DUF1778 domain-containing protein	Antitoxin
NL735_RS04960 (1029152)	1029152..1029330	-	179	Protein_973	IS3 family transposase	-
NL735_RS04965 (1029571)	1029571..1029897	+	327	WP_000393302.1	hypothetical protein	-
NL735_RS04970 (1030170)	1030170..1030517	-	348	WP_001669174.1	DUF1493 family protein	-
NL735_RS04975 (1030502)	1030502..1030951	-	450	WP_000381610.1	membrane protein	-
NL735_RS04980 (1031382)	1031382..1031825	-	444	WP_000715092.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
NL735_RS04985 (1032282)	1032282..1032932	+	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 Genomic island TA010052 4599654..4610080 0	inside	Genomic island	-	invH / invF / invG / invE / invA / invB	1027819..1038245	10426
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0	flank	IS/Tn	-	-	1027819..1027995	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T251133 WP_000971655.1 NZ_CP100707:c1028595-1028068 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10678.57 Da
• Isoelectric Point: 8.5779

>AT251133 WP_000855692.1 NZ_CP100707:c1028882-1028592 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• PDB: 7AK9
• AlphaFold DB: A0A625WHV3