Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1017723..1018537 | Replicon | chromosome |
Accession | NZ_CP100698 | ||
Organism | Salmonella enterica subsp. enterica serovar Agona strain R18.2256 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | B5F3Y4 |
Locus tag | NL710_RS04905 | Protein ID | WP_000971656.1 |
Coordinates | 1017723..1018250 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | NL710_RS04910 | Protein ID | WP_000855694.1 |
Coordinates | 1018247..1018537 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL710_RS04875 (1014023) | 1014023..1014444 | + | 422 | Protein_955 | cytoplasmic protein | - |
NL710_RS04880 (1014612) | 1014612..1014851 | + | 240 | Protein_956 | hypothetical protein | - |
NL710_RS04885 (1015008) | 1015008..1015676 | + | 669 | WP_000445914.1 | hypothetical protein | - |
NL710_RS04890 (1015703) | 1015703..1016197 | + | 495 | WP_000424943.1 | hypothetical protein | - |
NL710_RS04895 (1016442) | 1016442..1017098 | - | 657 | WP_000420449.1 | protein-serine/threonine phosphatase | - |
NL710_RS04900 (1017448) | 1017448..1017650 | + | 203 | Protein_960 | IS5/IS1182 family transposase | - |
NL710_RS04905 (1017723) | 1017723..1018250 | - | 528 | WP_000971656.1 | GNAT family N-acetyltransferase | Toxin |
NL710_RS04910 (1018247) | 1018247..1018537 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
NL710_RS04915 (1019130) | 1019130..1019456 | + | 327 | WP_000393296.1 | hypothetical protein | - |
NL710_RS04920 (1019729) | 1019729..1020076 | - | 348 | WP_001555786.1 | DUF1493 family protein | - |
NL710_RS04925 (1020061) | 1020061..1020510 | - | 450 | WP_000381619.1 | hypothetical protein | - |
NL710_RS04930 (1020942) | 1020942..1021385 | - | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NL710_RS04935 (1021841) | 1021841..1022491 | + | 651 | WP_001747511.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1017474..1027804 | 10330 | ||
flank | IS/Tn | - | - | 1017474..1017650 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19156.98 Da Isoelectric Point: 9.6420
>T251089 WP_000971656.1 NZ_CP100698:c1018250-1017723 [Salmonella enterica subsp. enterica serovar Agona]
MMFTDWHEAAIGKTHNRMNFDCGNADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHSFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLDRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGNADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHSFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLDRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT251089 WP_000855694.1 NZ_CP100698:c1018537-1018247 [Salmonella enterica subsp. enterica serovar Agona]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3J3UPI2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |