Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1076322..1077136 | Replicon | chromosome |
Accession | NZ_CP100691 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R17.3867 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | NL690_RS05180 | Protein ID | WP_000971655.1 |
Coordinates | 1076322..1076849 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | NL690_RS05185 | Protein ID | WP_000855692.1 |
Coordinates | 1076846..1077136 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL690_RS05160 (1071622) | 1071622..1074189 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
NL690_RS05165 (1074348) | 1074348..1074869 | + | 522 | WP_000858988.1 | hypothetical protein | - |
NL690_RS05170 (1075041) | 1075041..1075697 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
NL690_RS05175 (1076044) | 1076044..1076249 | + | 206 | Protein_1016 | IS5/IS1182 family transposase | - |
NL690_RS05180 (1076322) | 1076322..1076849 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
NL690_RS05185 (1076846) | 1076846..1077136 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
NL690_RS05190 (1077406) | 1077406..1077584 | - | 179 | Protein_1019 | IS3 family transposase | - |
NL690_RS05195 (1077825) | 1077825..1078151 | + | 327 | WP_254520966.1 | hypothetical protein | - |
NL690_RS05200 (1078424) | 1078424..1078771 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
NL690_RS05205 (1078756) | 1078756..1079205 | - | 450 | WP_000381610.1 | membrane protein | - |
NL690_RS05210 (1079636) | 1079636..1080079 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NL690_RS05215 (1080536) | 1080536..1081186 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1076073..1086499 | 10426 | ||
flank | IS/Tn | - | - | 1076073..1076249 | 176 | ||
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1075041..1086499 | 11458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T251038 WP_000971655.1 NZ_CP100691:c1076849-1076322 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10678.57 Da Isoelectric Point: 8.5779
>AT251038 WP_000855692.1 NZ_CP100691:c1077136-1076846 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK9 | |
AlphaFold DB | A0A625WHV3 |