Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 879586..880211 | Replicon | chromosome |
| Accession | NZ_CP099705 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain 013+ | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NG892_RS04315 | Protein ID | WP_080247813.1 |
| Coordinates | 879813..880211 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | NG892_RS04310 | Protein ID | WP_000557549.1 |
| Coordinates | 879586..879813 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NG892_RS04280 (874631) | 874631..876148 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| NG892_RS04285 (876224) | 876224..876769 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
| NG892_RS04290 (877034) | 877034..877792 | + | 759 | WP_000244329.1 | amidase activator ActS | - |
| NG892_RS04300 (878077) | 878077..878883 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
| NG892_RS04305 (879158) | 879158..879409 | - | 252 | WP_001540858.1 | hypothetical protein | - |
| NG892_RS04310 (879586) | 879586..879813 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NG892_RS04315 (879813) | 879813..880211 | + | 399 | WP_080247813.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| NG892_RS04320 (881017) | 881017..881553 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
| NG892_RS04325 (881600) | 881600..882232 | + | 633 | WP_000835265.1 | YfdX family protein | - |
| NG892_RS04330 (882951) | 882951..883535 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 878077..889402 | 11325 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14926.24 Da Isoelectric Point: 7.2155
>T249292 WP_080247813.1 NZ_CP099705:879813-880211 [Salmonella enterica subsp. enterica serovar Typhimurium]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRTEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRTEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|