Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 89914..90439 | Replicon | plasmid unnamed |
Accession | NZ_CP099589 | ||
Organism | Escherichia coli strain EMG2 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | NHF38_RS23210 | Protein ID | WP_001159868.1 |
Coordinates | 89914..90219 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | NHF38_RS23215 | Protein ID | WP_000813634.1 |
Coordinates | 90221..90439 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHF38_RS23195 (85824) | 85824..86990 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
NHF38_RS23200 (87578) | 87578..88333 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
NHF38_RS23205 (89107) | 89107..89913 | - | 807 | WP_000016982.1 | site-specific integrase | - |
NHF38_RS23210 (89914) | 89914..90219 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
NHF38_RS23215 (90221) | 90221..90439 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
NHF38_RS23220 (91019) | 91019..92107 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
NHF38_RS23225 (92109) | 92109..94334 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
NHF38_RS23230 (94384) | 94384..95283 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Conjugative plasmid | - | - | 1..99158 | 99158 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T249162 WP_001159868.1 NZ_CP099589:c90219-89914 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|