Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 44189..44814 | Replicon | plasmid unnamed |
Accession | NZ_CP099589 | ||
Organism | Escherichia coli strain EMG2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NHF38_RS22920 | Protein ID | WP_000911324.1 |
Coordinates | 44416..44814 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | L4J1D2 |
Locus tag | NHF38_RS22915 | Protein ID | WP_000450532.1 |
Coordinates | 44189..44416 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHF38_RS22915 (44189) | 44189..44416 | + | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NHF38_RS22920 (44416) | 44416..44814 | + | 399 | WP_000911324.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NHF38_RS22925 (44823) | 44823..46976 | - | 2154 | WP_000009350.1 | type IV conjugative transfer system coupling protein TraD | - |
NHF38_RS22930 (47229) | 47229..47960 | - | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
NHF38_RS22935 (47985) | 47985..48506 | - | 522 | WP_000632670.1 | conjugal transfer entry exclusion protein TraS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Conjugative plasmid | - | - | 1..99158 | 99158 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14800.09 Da Isoelectric Point: 7.8604
>T249158 WP_000911324.1 NZ_CP099589:44416-44814 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|