Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 881616..882241 | Replicon | chromosome |
| Accession | NZ_CP098834 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain GD19PS1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | M7SD17 |
| Locus tag | NFH28_RS04290 | Protein ID | WP_000911336.1 |
| Coordinates | 881843..882241 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | NFH28_RS04285 | Protein ID | WP_000557549.1 |
| Coordinates | 881616..881843 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFH28_RS04255 (876661) | 876661..878178 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| NFH28_RS04260 (878254) | 878254..878799 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
| NFH28_RS04265 (879064) | 879064..879822 | + | 759 | WP_000244329.1 | amidase activator ActS | - |
| NFH28_RS04275 (880107) | 880107..880913 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
| NFH28_RS04280 (881188) | 881188..881439 | - | 252 | WP_001540858.1 | hypothetical protein | - |
| NFH28_RS04285 (881616) | 881616..881843 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NFH28_RS04290 (881843) | 881843..882241 | + | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| NFH28_RS04295 (883047) | 883047..883583 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
| NFH28_RS04300 (883630) | 883630..884262 | + | 633 | WP_000835265.1 | YfdX family protein | - |
| NFH28_RS04305 (884981) | 884981..885565 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 880107..891432 | 11325 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T248150 WP_000911336.1 NZ_CP098834:881843-882241 [Salmonella enterica subsp. enterica serovar Typhimurium]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFC | |
| PDB | 6IFM |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFM | |
| AlphaFold DB | A0A3V2Y5V5 |