Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1408847..1409472 | Replicon | chromosome |
| Accession | NZ_CP098741 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain HJL222 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | M7SD17 |
| Locus tag | NCG87_RS06870 | Protein ID | WP_000911336.1 |
| Coordinates | 1408847..1409245 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | NCG87_RS06875 | Protein ID | WP_000557549.1 |
| Coordinates | 1409245..1409472 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NCG87_RS06850 (1404811) | 1404811..1405395 | - | 585 | WP_001244638.1 | fimbrial protein | - |
| NCG87_RS06855 (1406114) | 1406114..1406746 | - | 633 | WP_000835265.1 | YfdX family protein | - |
| NCG87_RS06860 (1406793) | 1406793..1407329 | - | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
| NCG87_RS06865 (1408009) | 1408009..1408467 | - | 459 | WP_000502119.1 | IS200/IS605-like element IS200F family transposase | - |
| NCG87_RS06870 (1408847) | 1408847..1409245 | - | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| NCG87_RS06875 (1409245) | 1409245..1409472 | - | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NCG87_RS06880 (1409649) | 1409649..1409900 | + | 252 | WP_001540858.1 | hypothetical protein | - |
| NCG87_RS06885 (1410175) | 1410175..1410981 | + | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
| NCG87_RS06895 (1411266) | 1411266..1412024 | - | 759 | WP_000244329.1 | amidase activator ActS | - |
| NCG87_RS06900 (1412289) | 1412289..1412834 | + | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
| NCG87_RS06905 (1412910) | 1412910..1414427 | - | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 1399689..1410981 | 11292 | ||
| flank | IS/Tn | - | - | 1408009..1408467 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T247950 WP_000911336.1 NZ_CP098741:c1409245-1408847 [Salmonella enterica subsp. enterica serovar Typhimurium]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFC | |
| PDB | 6IFM |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFM | |
| AlphaFold DB | A0A3V2Y5V5 |