Detailed information of TA system TA247621

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 1038645..1039459
• Replicon: chromosome
• Accession: NZ_CP098438
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: M9193_RS04955
• Protein ID: WP_000971655.1
• Coordinates: 1038645..1039172 (-)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: E8XL32
• Locus tag: M9193_RS04960
• Protein ID: WP_000855692.1
• Coordinates: 1039169..1039459 (-)
• Length: 97 a.a.

Genomic Context

Location: 1036671..1037192 (522 bp)
Type: Others
Protein ID: WP_000858988.1

Location: 1038367..1038572 (206 bp)
Type: Others
Protein ID: Protein_973

Location: 1040148..1040474 (327 bp)
Type: Others
Protein ID: WP_000393302.1

Location: 1042859..1043509 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 1033945..1036512 (2568 bp)
Type: Others
Protein ID: WP_088365275.1

Location: 1037364..1038020 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 1038645..1039172 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 1039169..1039459 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1

Location: 1039729..1039907 (179 bp)
Type: Others
Protein ID: Protein_976

Location: 1040747..1041094 (348 bp)
Type: Others
Protein ID: WP_001669174.1

Location: 1041079..1041528 (450 bp)
Type: Others
Protein ID: WP_000381610.1

Location: 1041959..1042402 (444 bp)
Type: Others
Protein ID: WP_000715092.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M9193_RS04935 (1033945)	1033945..1036512	-	2568	WP_088365275.1	DNA mismatch repair protein MutS	-
M9193_RS04940 (1036671)	1036671..1037192	+	522	WP_000858988.1	hypothetical protein	-
M9193_RS04945 (1037364)	1037364..1038020	-	657	WP_000420452.1	protein-serine/threonine phosphatase	-
M9193_RS04950 (1038367)	1038367..1038572	+	206	Protein_973	IS5/IS1182 family transposase	-
M9193_RS04955 (1038645)	1038645..1039172	-	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
M9193_RS04960 (1039169)	1039169..1039459	-	291	WP_000855692.1	DUF1778 domain-containing protein	Antitoxin
M9193_RS04965 (1039729)	1039729..1039907	-	179	Protein_976	IS3 family transposase	-
M9193_RS04970 (1040148)	1040148..1040474	+	327	WP_000393302.1	hypothetical protein	-
M9193_RS04975 (1040747)	1040747..1041094	-	348	WP_001669174.1	DUF1493 family protein	-
M9193_RS04980 (1041079)	1041079..1041528	-	450	WP_000381610.1	membrane protein	-
M9193_RS04985 (1041959)	1041959..1042402	-	444	WP_000715092.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
M9193_RS04990 (1042859)	1042859..1043509	+	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 Genomic island TA010052 4599654..4610080 0	inside	Genomic island	-	invH / invF / invG / invE / invA / invB	1038396..1048822	10426
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0	flank	IS/Tn	-	-	1038396..1038572	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T247621 WP_000971655.1 NZ_CP098438:c1039172-1038645 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10678.57 Da
• Isoelectric Point: 8.5779

>AT247621 WP_000855692.1 NZ_CP098438:c1039459-1039169 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• PDB: 7AK9
• AlphaFold DB: A0A625WHV3