Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 890987..891612 | Replicon | chromosome |
Accession | NZ_CP098438 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATOMSal-L6 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M7SD17 |
Locus tag | M9193_RS04295 | Protein ID | WP_000911336.1 |
Coordinates | 891214..891612 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | M9193_RS04290 | Protein ID | WP_000557549.1 |
Coordinates | 890987..891214 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9193_RS04260 (886032) | 886032..887549 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
M9193_RS04265 (887625) | 887625..888170 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
M9193_RS04270 (888435) | 888435..889193 | + | 759 | WP_000244329.1 | amidase activator ActS | - |
M9193_RS04280 (889478) | 889478..890284 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
M9193_RS04285 (890559) | 890559..890810 | - | 252 | WP_001540858.1 | hypothetical protein | - |
M9193_RS04290 (890987) | 890987..891214 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
M9193_RS04295 (891214) | 891214..891612 | + | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
M9193_RS04300 (891992) | 891992..892450 | + | 459 | WP_000502119.1 | IS200/IS605-like element IS200F family transposase | - |
M9193_RS04305 (893130) | 893130..893666 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
M9193_RS04310 (893713) | 893713..894345 | + | 633 | WP_000835265.1 | YfdX family protein | - |
M9193_RS04315 (895064) | 895064..895648 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 889478..901515 | 12037 | ||
flank | IS/Tn | - | - | 891992..892450 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T247620 WP_000911336.1 NZ_CP098438:891214-891612 [Salmonella enterica subsp. enterica serovar Typhimurium]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6IFC | |
PDB | 6IFM |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6IFM | |
AlphaFold DB | A0A3V2Y5V5 |