Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 4415073..4415662 Replicon chromosome
Accession NZ_CP097528
Organism Pseudomonas putida strain KT2440 isolate pMBEC6

Toxin (Protein)


Gene name hicA Uniprot ID Q88G26
Locus tag M8003_RS20480 Protein ID WP_010954726.1
Coordinates 4415414..4415662 (-) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A2V4F1F2
Locus tag M8003_RS20475 Protein ID WP_049587764.1
Coordinates 4415073..4415414 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8003_RS20440 (M8003_20410) 4410324..4411154 - 831 WP_010954720.1 replication protein -
M8003_RS20445 (M8003_20415) 4411479..4411691 - 213 WP_010954721.1 YdaS family helix-turn-helix protein -
M8003_RS20450 (M8003_20420) 4411779..4412426 + 648 WP_010954722.1 S24 family peptidase -
M8003_RS20455 (M8003_20425) 4412484..4412897 + 414 WP_010954723.1 HIRAN domain-containing protein -
M8003_RS20460 (M8003_20430) 4412941..4413177 + 237 WP_010954724.1 hypothetical protein -
M8003_RS20465 (M8003_20435) 4413344..4414336 + 993 WP_049587768.1 hypothetical protein -
M8003_RS20470 (M8003_20440) 4414339..4414905 + 567 WP_049587766.1 hypothetical protein -
M8003_RS20475 (M8003_20445) 4415073..4415414 - 342 WP_049587764.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M8003_RS20480 (M8003_20450) 4415414..4415662 - 249 WP_010954726.1 type II toxin-antitoxin system HicA family toxin Toxin
M8003_RS20485 (M8003_20455) 4415812..4416072 + 261 WP_010954727.1 DUF1654 domain-containing protein -
M8003_RS20490 (M8003_20460) 4416444..4416653 + 210 WP_049587762.1 hypothetical protein -
M8003_RS20495 (M8003_20465) 4417290..4417673 + 384 WP_049587761.1 helix-turn-helix transcriptional regulator -
M8003_RS20500 (M8003_20470) 4417693..4417962 + 270 WP_010954732.1 hypothetical protein -
M8003_RS20505 (M8003_20475) 4417959..4418417 + 459 WP_010954733.1 hypothetical protein -
M8003_RS20510 (M8003_20480) 4418499..4418849 + 351 WP_010954734.1 hypothetical protein -
M8003_RS20515 (M8003_20485) 4418863..4419141 - 279 WP_010954735.1 hypothetical protein -
M8003_RS20520 (M8003_20490) 4419248..4419799 + 552 WP_049587760.1 hypothetical protein -
M8003_RS20525 (M8003_20495) 4419814..4420197 + 384 WP_010954737.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4377660..4431312 53652


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-76)

Antitoxin

Uncharacterised protein family HicB

(55-105)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9137.67 Da        Isoelectric Point: 10.4156

>T245536 WP_010954726.1 NZ_CP097528:c4415662-4415414 [Pseudomonas putida]
MSKQEKLLAKLLNKQAGFTWPELVTLLGGLGYRHIEGDGSRVKFDNGHPQAMINLHKPHPGNELKAYVKRQVIEHLKAGG
LI

Download         Length: 249 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12402.90 Da        Isoelectric Point: 5.0719

>AT245536 WP_049587764.1 NZ_CP097528:c4415414-4415073 [Pseudomonas putida]
MSTMLQYRGYYGSIEASPEDNCLFGKLQFIRALVSYEGETVAELTQAFRDAVDDYLDTCASLGQNPEIPCKGSFNVRVGH
DLHLAASVAATKQSISLNDLTRKALSEYLGHHA

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q88G26

Antitoxin

Source ID Structure
AlphaFold DB A0A2V4F1F2

References