244858

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 47932..48196 Replicon plasmid pAR13438_2
Accession NZ_CP097172
Organism Escherichia coli strain AR13438

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag M3M51_RS24885 Protein ID WP_001331364.1
Coordinates 48044..48196 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 47932..47994 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3M51_RS24870 (43171) 43171..45462 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
M3M51_RS24875 (45455) 45455..46525 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
M3M51_RS24880 (46544) 46544..47752 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (47932) 47932..47994 - 63 NuclAT_0 - Antitoxin
- (47932) 47932..47994 - 63 NuclAT_0 - Antitoxin
- (47932) 47932..47994 - 63 NuclAT_0 - Antitoxin
- (47932) 47932..47994 - 63 NuclAT_0 - Antitoxin
M3M51_RS24885 (48044) 48044..48196 + 153 WP_001331364.1 Hok/Gef family protein Toxin
M3M51_RS24890 (48268) 48268..48519 - 252 WP_001291964.1 hypothetical protein -
M3M51_RS24895 (49018) 49018..49113 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
M3M51_RS24900 (49178) 49178..49354 - 177 WP_001054897.1 hypothetical protein -
M3M51_RS24905 (49746) 49746..49955 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
M3M51_RS24910 (50027) 50027..50677 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
M3M51_RS24915 (50751) 50751..52919 - 2169 WP_000698357.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Conjugative plasmid blaCMY-33 - 1..96934 96934


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T244858 WP_001331364.1 NZ_CP097172:48044-48196 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT244858 NZ_CP097172:c47994-47932 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References