Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 47932..48196 | Replicon | plasmid pAR13438_2 |
| Accession | NZ_CP097172 | ||
| Organism | Escherichia coli strain AR13438 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | M3M51_RS24885 | Protein ID | WP_001331364.1 |
| Coordinates | 48044..48196 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 47932..47994 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3M51_RS24870 (43171) | 43171..45462 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| M3M51_RS24875 (45455) | 45455..46525 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| M3M51_RS24880 (46544) | 46544..47752 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (47932) | 47932..47994 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (47932) | 47932..47994 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (47932) | 47932..47994 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (47932) | 47932..47994 | - | 63 | NuclAT_0 | - | Antitoxin |
| M3M51_RS24885 (48044) | 48044..48196 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| M3M51_RS24890 (48268) | 48268..48519 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| M3M51_RS24895 (49018) | 49018..49113 | + | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| M3M51_RS24900 (49178) | 49178..49354 | - | 177 | WP_001054897.1 | hypothetical protein | - |
| M3M51_RS24905 (49746) | 49746..49955 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| M3M51_RS24910 (50027) | 50027..50677 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| M3M51_RS24915 (50751) | 50751..52919 | - | 2169 | WP_000698357.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Conjugative plasmid | blaCMY-33 | - | 1..96934 | 96934 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T244858 WP_001331364.1 NZ_CP097172:48044-48196 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT244858 NZ_CP097172:c47994-47932 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|