Detailed information of TA system TA202569

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 995773..996587
• Replicon: chromosome
• Accession: NZ_CP074663
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium strain CFSAN008081

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: BG493_RS04755
• Protein ID: WP_000971655.1
• Coordinates: 995773..996300 (-)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: E8XL32
• Locus tag: BG493_RS04760
• Protein ID: WP_000855692.1
• Coordinates: 996297..996587 (-)
• Length: 97 a.a.

Genomic Context

Location: 993799..994320 (522 bp)
Type: Others
Protein ID: WP_000858988.1

Location: 995495..995700 (206 bp)
Type: Others
Protein ID: Protein_932

Location: 997276..997602 (327 bp)
Type: Others
Protein ID: WP_000393302.1

Location: 999987..1000637 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 991073..993640 (2568 bp)
Type: Others
Protein ID: WP_001005807.1

Location: 994492..995148 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 995773..996300 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 996297..996587 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1

Location: 996857..997035 (179 bp)
Type: Others
Protein ID: Protein_935

Location: 997875..998222 (348 bp)
Type: Others
Protein ID: WP_001669174.1

Location: 998207..998656 (450 bp)
Type: Others
Protein ID: WP_000381610.1

Location: 999087..999530 (444 bp)
Type: Others
Protein ID: WP_000715092.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BG493_RS04735 (991073)	991073..993640	-	2568	WP_001005807.1	DNA mismatch repair protein MutS	-
BG493_RS04740 (993799)	993799..994320	+	522	WP_000858988.1	hypothetical protein	-
BG493_RS04745 (994492)	994492..995148	-	657	WP_000420452.1	protein-serine/threonine phosphatase	-
BG493_RS04750 (995495)	995495..995700	+	206	Protein_932	IS5/IS1182 family transposase	-
BG493_RS04755 (995773)	995773..996300	-	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
BG493_RS04760 (996297)	996297..996587	-	291	WP_000855692.1	DUF1778 domain-containing protein	Antitoxin
BG493_RS04765 (996857)	996857..997035	-	179	Protein_935	IS3 family transposase	-
BG493_RS04770 (997276)	997276..997602	+	327	WP_000393302.1	hypothetical protein	-
BG493_RS04775 (997875)	997875..998222	-	348	WP_001669174.1	DUF1493 family protein	-
BG493_RS04780 (998207)	998207..998656	-	450	WP_000381610.1	membrane protein	-
BG493_RS04785 (999087)	999087..999530	-	444	WP_000715092.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
BG493_RS04790 (999987)	999987..1000637	+	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 Genomic island TA010052 4599654..4610080 0.003	inside	Genomic island	-	invH / invF / invG / invE / invA / invB	994492..1005950	11458
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0	flank	IS/Tn	-	-	995524..995700	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T202569 WP_000971655.1 NZ_CP074663:c996300-995773 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

>T202569 NZ_CP099506:c1812465-1812361 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10678.57 Da
• Isoelectric Point: 8.5779

>AT202569 WP_000855692.1 NZ_CP074663:c996587-996297 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

>AT202569 NZ_CP099506:1812267-1812305 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• PDB: 7AK9
• AlphaFold DB: A0A625WHV3