Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 995773..996587 | Replicon | chromosome |
Accession | NZ_CP074663 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain CFSAN008081 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | BG493_RS04755 | Protein ID | WP_000971655.1 |
Coordinates | 995773..996300 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | BG493_RS04760 | Protein ID | WP_000855692.1 |
Coordinates | 996297..996587 (-) | Length | 97 a.a. |
Genomic Context
Location: 993799..994320 (522 bp)
Type: Others
Protein ID: WP_000858988.1
Type: Others
Protein ID: WP_000858988.1
Location: 995495..995700 (206 bp)
Type: Others
Protein ID: Protein_932
Type: Others
Protein ID: Protein_932
Location: 997276..997602 (327 bp)
Type: Others
Protein ID: WP_000393302.1
Type: Others
Protein ID: WP_000393302.1
Location: 999987..1000637 (651 bp)
Type: Others
Protein ID: WP_001674874.1
Type: Others
Protein ID: WP_001674874.1
Location: 991073..993640 (2568 bp)
Type: Others
Protein ID: WP_001005807.1
Type: Others
Protein ID: WP_001005807.1
Location: 994492..995148 (657 bp)
Type: Others
Protein ID: WP_000420452.1
Type: Others
Protein ID: WP_000420452.1
Location: 995773..996300 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1
Type: Toxin
Protein ID: WP_000971655.1
Location: 996297..996587 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1
Type: Antitoxin
Protein ID: WP_000855692.1
Location: 996857..997035 (179 bp)
Type: Others
Protein ID: Protein_935
Type: Others
Protein ID: Protein_935
Location: 997875..998222 (348 bp)
Type: Others
Protein ID: WP_001669174.1
Type: Others
Protein ID: WP_001669174.1
Location: 998207..998656 (450 bp)
Type: Others
Protein ID: WP_000381610.1
Type: Others
Protein ID: WP_000381610.1
Location: 999087..999530 (444 bp)
Type: Others
Protein ID: WP_000715092.1
Type: Others
Protein ID: WP_000715092.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BG493_RS04735 (991073) | 991073..993640 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
BG493_RS04740 (993799) | 993799..994320 | + | 522 | WP_000858988.1 | hypothetical protein | - |
BG493_RS04745 (994492) | 994492..995148 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
BG493_RS04750 (995495) | 995495..995700 | + | 206 | Protein_932 | IS5/IS1182 family transposase | - |
BG493_RS04755 (995773) | 995773..996300 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
BG493_RS04760 (996297) | 996297..996587 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
BG493_RS04765 (996857) | 996857..997035 | - | 179 | Protein_935 | IS3 family transposase | - |
BG493_RS04770 (997276) | 997276..997602 | + | 327 | WP_000393302.1 | hypothetical protein | - |
BG493_RS04775 (997875) | 997875..998222 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
BG493_RS04780 (998207) | 998207..998656 | - | 450 | WP_000381610.1 | membrane protein | - |
BG493_RS04785 (999087) | 999087..999530 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
BG493_RS04790 (999987) | 999987..1000637 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 994492..1005950 | 11458 | ||
flank | IS/Tn | - | - | 995524..995700 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T202569 WP_000971655.1 NZ_CP074663:c996300-995773 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
>T202569 NZ_CP099506:c1812465-1812361 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 97 a.a. Molecular weight: 10678.57 Da Isoelectric Point: 8.5779
>AT202569 WP_000855692.1 NZ_CP074663:c996587-996297 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
>AT202569 NZ_CP099506:1812267-1812305 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC