Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1029272..1030086 | Replicon | chromosome |
Accession | NZ_CP047525 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain SJTUF11077 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | DXN14_RS04960 | Protein ID | WP_000971655.1 |
Coordinates | 1029272..1029799 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | DXN14_RS04965 | Protein ID | WP_000855692.1 |
Coordinates | 1029796..1030086 (-) | Length | 97 a.a. |
Genomic Context
Location: 1027298..1027819 (522 bp)
Type: Others
Protein ID: WP_000858988.1
Type: Others
Protein ID: WP_000858988.1
Location: 1028994..1029199 (206 bp)
Type: Others
Protein ID: Protein_975
Type: Others
Protein ID: Protein_975
Location: 1030775..1031101 (327 bp)
Type: Others
Protein ID: WP_000393302.1
Type: Others
Protein ID: WP_000393302.1
Location: 1033486..1034136 (651 bp)
Type: Others
Protein ID: WP_001674874.1
Type: Others
Protein ID: WP_001674874.1
Location: 1024572..1027139 (2568 bp)
Type: Others
Protein ID: WP_001005807.1
Type: Others
Protein ID: WP_001005807.1
Location: 1027991..1028647 (657 bp)
Type: Others
Protein ID: WP_000420452.1
Type: Others
Protein ID: WP_000420452.1
Location: 1029272..1029799 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1
Type: Toxin
Protein ID: WP_000971655.1
Location: 1029796..1030086 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1
Type: Antitoxin
Protein ID: WP_000855692.1
Location: 1030356..1030534 (179 bp)
Type: Others
Protein ID: Protein_978
Type: Others
Protein ID: Protein_978
Location: 1031374..1031721 (348 bp)
Type: Others
Protein ID: WP_001669174.1
Type: Others
Protein ID: WP_001669174.1
Location: 1031706..1032155 (450 bp)
Type: Others
Protein ID: WP_000381610.1
Type: Others
Protein ID: WP_000381610.1
Location: 1032586..1033029 (444 bp)
Type: Others
Protein ID: WP_000715092.1
Type: Others
Protein ID: WP_000715092.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXN14_RS04940 (1024572) | 1024572..1027139 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
DXN14_RS04945 (1027298) | 1027298..1027819 | + | 522 | WP_000858988.1 | hypothetical protein | - |
DXN14_RS04950 (1027991) | 1027991..1028647 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
DXN14_RS04955 (1028994) | 1028994..1029199 | + | 206 | Protein_975 | IS5/IS1182 family transposase | - |
DXN14_RS04960 (1029272) | 1029272..1029799 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
DXN14_RS04965 (1029796) | 1029796..1030086 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
DXN14_RS04970 (1030356) | 1030356..1030534 | - | 179 | Protein_978 | IS3 family transposase | - |
DXN14_RS04975 (1030775) | 1030775..1031101 | + | 327 | WP_000393302.1 | hypothetical protein | - |
DXN14_RS04980 (1031374) | 1031374..1031721 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
DXN14_RS04985 (1031706) | 1031706..1032155 | - | 450 | WP_000381610.1 | membrane protein | - |
DXN14_RS04990 (1032586) | 1032586..1033029 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
DXN14_RS04995 (1033486) | 1033486..1034136 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1029023..1039449 | 10426 | ||
flank | IS/Tn | - | - | 1029023..1029199 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T146362 WP_000971655.1 NZ_CP047525:c1029799-1029272 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
>T146362 NZ_CP062744:283379-283486 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 97 a.a. Molecular weight: 10678.57 Da Isoelectric Point: 8.5779
>AT146362 WP_000855692.1 NZ_CP047525:c1030086-1029796 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
>AT146362 NZ_CP062744:c283331-283265 [Escherichia coli O157:H7]
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT