Detailed information of TA system TA146362

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 1029272..1030086
• Replicon: chromosome
• Accession: NZ_CP047525
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium strain SJTUF11077

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: DXN14_RS04960
• Protein ID: WP_000971655.1
• Coordinates: 1029272..1029799 (-)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: E8XL32
• Locus tag: DXN14_RS04965
• Protein ID: WP_000855692.1
• Coordinates: 1029796..1030086 (-)
• Length: 97 a.a.

Genomic Context

Location: 1027298..1027819 (522 bp)
Type: Others
Protein ID: WP_000858988.1

Location: 1028994..1029199 (206 bp)
Type: Others
Protein ID: Protein_975

Location: 1030775..1031101 (327 bp)
Type: Others
Protein ID: WP_000393302.1

Location: 1033486..1034136 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 1024572..1027139 (2568 bp)
Type: Others
Protein ID: WP_001005807.1

Location: 1027991..1028647 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 1029272..1029799 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 1029796..1030086 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1

Location: 1030356..1030534 (179 bp)
Type: Others
Protein ID: Protein_978

Location: 1031374..1031721 (348 bp)
Type: Others
Protein ID: WP_001669174.1

Location: 1031706..1032155 (450 bp)
Type: Others
Protein ID: WP_000381610.1

Location: 1032586..1033029 (444 bp)
Type: Others
Protein ID: WP_000715092.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
DXN14_RS04940 (1024572)	1024572..1027139	-	2568	WP_001005807.1	DNA mismatch repair protein MutS	-
DXN14_RS04945 (1027298)	1027298..1027819	+	522	WP_000858988.1	hypothetical protein	-
DXN14_RS04950 (1027991)	1027991..1028647	-	657	WP_000420452.1	protein-serine/threonine phosphatase	-
DXN14_RS04955 (1028994)	1028994..1029199	+	206	Protein_975	IS5/IS1182 family transposase	-
DXN14_RS04960 (1029272)	1029272..1029799	-	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
DXN14_RS04965 (1029796)	1029796..1030086	-	291	WP_000855692.1	DUF1778 domain-containing protein	Antitoxin
DXN14_RS04970 (1030356)	1030356..1030534	-	179	Protein_978	IS3 family transposase	-
DXN14_RS04975 (1030775)	1030775..1031101	+	327	WP_000393302.1	hypothetical protein	-
DXN14_RS04980 (1031374)	1031374..1031721	-	348	WP_001669174.1	DUF1493 family protein	-
DXN14_RS04985 (1031706)	1031706..1032155	-	450	WP_000381610.1	membrane protein	-
DXN14_RS04990 (1032586)	1032586..1033029	-	444	WP_000715092.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
DXN14_RS04995 (1033486)	1033486..1034136	+	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 Genomic island TA010052 4599654..4610080 0	inside	Genomic island	-	invH / invF / invG / invE / invA / invB	1029023..1039449	10426
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0	flank	IS/Tn	-	-	1029023..1029199	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T146362 WP_000971655.1 NZ_CP047525:c1029799-1029272 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

>T146362 NZ_CP062744:283379-283486 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10678.57 Da
• Isoelectric Point: 8.5779

>AT146362 WP_000855692.1 NZ_CP047525:c1030086-1029796 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

>AT146362 NZ_CP062744:c283331-283265 [Escherichia coli O157:H7]
GGTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• PDB: 7AK9
• AlphaFold DB: A0A625WHV3