Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 42874..43138 | Replicon | plasmid pGM351-2 |
Accession | NZ_CP038417 | ||
Organism | Escherichia coli O157:H7 strain 3-5-1 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | E4U90_RS27310 | Protein ID | WP_001331364.1 |
Coordinates | 42986..43138 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 42874..42931 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4U90_RS27295 | 38113..40404 | - | 2292 | WP_001289276.1 | hypothetical protein | - |
E4U90_RS27300 | 40397..41467 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
E4U90_RS27305 | 41486..42694 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 42874..42931 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 42874..42931 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 42874..42931 | - | 58 | NuclAT_0 | - | Antitoxin |
- | 42874..42931 | - | 58 | NuclAT_0 | - | Antitoxin |
E4U90_RS27310 | 42986..43138 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
E4U90_RS27315 | 43210..43461 | - | 252 | WP_001291964.1 | hypothetical protein | - |
E4U90_RS27320 | 44120..44296 | - | 177 | WP_001054897.1 | hypothetical protein | - |
E4U90_RS27325 | 44688..44897 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
E4U90_RS27330 | 44969..45619 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
E4U90_RS27335 | 45693..47861 | - | 2169 | WP_001774191.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Conjugative plasmid | - | - | 1..89216 | 89216 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T122603 WP_001331364.1 NZ_CP038417:42986-43138 [Escherichia coli O157:H7]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T122603 NZ_CP038417:42986-43138 [Escherichia coli O157:H7]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT122603 NZ_CP038417:c42931-42874 [Escherichia coli O157:H7]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|