Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABEG41_RS16315 Genome accession   NZ_CP155795
Coordinates   3125617..3125757 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain D137     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3120617..3130757
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABEG41_RS16290 (ABEG41_16290) yuxO 3120892..3121272 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  ABEG41_RS16295 (ABEG41_16295) comA 3121291..3121935 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ABEG41_RS16300 (ABEG41_16300) - 3122016..3124329 (-) 2314 Protein_3144 histidine kinase -
  ABEG41_RS16305 (ABEG41_16305) comX 3124345..3124566 (-) 222 WP_014114983.1 competence pheromone ComX -
  ABEG41_RS16310 (ABEG41_16310) - 3124563..3125432 (-) 870 WP_015714626.1 polyprenyl synthetase family protein -
  ABEG41_RS16315 (ABEG41_16315) degQ 3125617..3125757 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ABEG41_RS16320 (ABEG41_16320) - 3125979..3126104 (+) 126 WP_141770195.1 hypothetical protein -
  ABEG41_RS16325 (ABEG41_16325) - 3126219..3126587 (+) 369 WP_014477834.1 hypothetical protein -
  ABEG41_RS16330 (ABEG41_16330) pdeH 3126563..3127792 (-) 1230 WP_014477835.1 cyclic di-GMP phosphodiesterase -
  ABEG41_RS16335 (ABEG41_16335) pncB 3127929..3129401 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ABEG41_RS16340 (ABEG41_16340) pncA 3129417..3129968 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  ABEG41_RS16345 (ABEG41_16345) yueI 3130065..3130463 (-) 399 WP_088467369.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=999415 ABEG41_RS16315 WP_003220708.1 3125617..3125757(-) (degQ) [Bacillus subtilis strain D137]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=999415 ABEG41_RS16315 WP_003220708.1 3125617..3125757(-) (degQ) [Bacillus subtilis strain D137]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment