Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | ABC810_RS08685 | Genome accession | NZ_CP155532 |
| Coordinates | 1716466..1716615 (-) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain SP264 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1711466..1721615
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABC810_RS08650 (ABC810_08640) | ccrZ | 1711659..1712453 (-) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| ABC810_RS08655 (ABC810_08645) | - | 1712614..1713225 (-) | 612 | WP_000394044.1 | type II CAAX endopeptidase family protein | - |
| ABC810_RS08660 (ABC810_08650) | blpZ | 1713376..1713609 (-) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| ABC810_RS08665 (ABC810_08655) | - | 1713651..1714340 (-) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| ABC810_RS08670 (ABC810_08660) | - | 1714392..1714775 (-) | 384 | WP_000877381.1 | hypothetical protein | - |
| ABC810_RS08675 (ABC810_08665) | - | 1715404..1715723 (-) | 320 | Protein_1669 | immunity protein | - |
| ABC810_RS08680 (ABC810_08670) | - | 1716243..1716362 (-) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| ABC810_RS08685 (ABC810_08675) | cipB | 1716466..1716615 (-) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| ABC810_RS08690 (ABC810_08680) | blpK | 1716859..1717107 (-) | 249 | WP_000379965.1 | bacteriocin-like peptide BlpK | - |
| ABC810_RS08695 (ABC810_08685) | blpJ | 1717176..1717445 (-) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| ABC810_RS08700 (ABC810_08690) | blpI | 1717912..1718109 (-) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| ABC810_RS08705 (ABC810_08695) | comA/nlmT | 1718391..1718978 (+) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| ABC810_RS08710 (ABC810_08700) | comA/nlmT | 1718905..1720548 (+) | 1644 | WP_075270826.1 | peptide cleavage/export ABC transporter | Regulator |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=997127 ABC810_RS08685 WP_001809846.1 1716466..1716615(-) (cipB) [Streptococcus pneumoniae strain SP264]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=997127 ABC810_RS08685 WP_001809846.1 1716466..1716615(-) (cipB) [Streptococcus pneumoniae strain SP264]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |