Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AAHT64_RS04285 Genome accession   NZ_CP155054
Coordinates   850779..850919 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain R38     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 845779..855919
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAHT64_RS04255 (AAHT64_04255) yueI 846074..846472 (+) 399 WP_019712929.1 YueI family protein -
  AAHT64_RS04260 (AAHT64_04260) pncA 846569..847120 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  AAHT64_RS04265 (AAHT64_04265) pncB 847136..848608 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AAHT64_RS04270 (AAHT64_04270) pdeH 848745..849974 (+) 1230 WP_003228790.1 cyclic di-GMP phosphodiesterase -
  AAHT64_RS04275 (AAHT64_04275) - 849950..850318 (-) 369 WP_014477834.1 hypothetical protein -
  AAHT64_RS04280 (AAHT64_04280) - 850432..850557 (-) 126 WP_003228793.1 hypothetical protein -
  AAHT64_RS04285 (AAHT64_04285) degQ 850779..850919 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AAHT64_RS04290 (AAHT64_04290) - 851104..851964 (+) 861 WP_029318489.1 polyprenyl synthetase family protein -
  AAHT64_RS04295 (AAHT64_04295) comX 851979..852140 (+) 162 WP_003228803.1 competence pheromone ComX -
  AAHT64_RS04300 (AAHT64_04300) comP 852148..854445 (+) 2298 WP_032730345.1 histidine kinase Regulator
  AAHT64_RS04305 (AAHT64_04305) comA 854526..855170 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AAHT64_RS04310 (AAHT64_04310) yuxO 855189..855569 (+) 381 WP_003228810.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=995825 AAHT64_RS04285 WP_003220708.1 850779..850919(+) (degQ) [Bacillus subtilis subsp. subtilis strain R38]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=995825 AAHT64_RS04285 WP_003220708.1 850779..850919(+) (degQ) [Bacillus subtilis subsp. subtilis strain R38]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment