Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AAVB50_RS05930 Genome accession   NZ_CP154923
Coordinates   1123805..1123945 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain FUA2233     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1118805..1128945
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVB50_RS05905 (AAVB50_05905) yueI 1119098..1119496 (+) 399 WP_345805925.1 YueI family protein -
  AAVB50_RS05910 (AAVB50_05910) pncA 1119593..1120144 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  AAVB50_RS05915 (AAVB50_05915) pncB 1120160..1121632 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AAVB50_RS05920 (AAVB50_05920) pdeH 1121769..1122998 (+) 1230 WP_345805927.1 cyclic di-GMP phosphodiesterase -
  AAVB50_RS05925 (AAVB50_05925) - 1122974..1123342 (-) 369 WP_017695529.1 hypothetical protein -
  AAVB50_RS05930 (AAVB50_05930) degQ 1123805..1123945 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AAVB50_RS05935 (AAVB50_05935) - 1124130..1124993 (+) 864 WP_345805928.1 polyprenyl synthetase family protein -
  AAVB50_RS05940 (AAVB50_05940) comX 1124995..1125216 (+) 222 WP_014480704.1 competence pheromone ComX -
  AAVB50_RS05945 (AAVB50_05945) comP 1125232..1127544 (+) 2313 WP_213418792.1 histidine kinase Regulator
  AAVB50_RS05950 (AAVB50_05950) comA 1127625..1128269 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AAVB50_RS05955 (AAVB50_05955) yuxO 1128288..1128668 (+) 381 WP_014477831.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=995515 AAVB50_RS05930 WP_003220708.1 1123805..1123945(+) (degQ) [Bacillus subtilis strain FUA2233]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=995515 AAVB50_RS05930 WP_003220708.1 1123805..1123945(+) (degQ) [Bacillus subtilis strain FUA2233]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment