Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AAVB74_RS06160 Genome accession   NZ_CP154920
Coordinates   1188310..1188450 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain FUA2232     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1183310..1193450
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVB74_RS06135 (AAVB74_06135) yueI 1183603..1184001 (+) 399 WP_345805925.1 YueI family protein -
  AAVB74_RS06140 (AAVB74_06140) pncA 1184098..1184649 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  AAVB74_RS06145 (AAVB74_06145) pncB 1184665..1186137 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AAVB74_RS06150 (AAVB74_06150) pdeH 1186274..1187503 (+) 1230 WP_345805927.1 cyclic di-GMP phosphodiesterase -
  AAVB74_RS06155 (AAVB74_06155) - 1187479..1187847 (-) 369 WP_017695529.1 hypothetical protein -
  AAVB74_RS06160 (AAVB74_06160) degQ 1188310..1188450 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AAVB74_RS06165 (AAVB74_06165) - 1188635..1189498 (+) 864 WP_345805928.1 polyprenyl synthetase family protein -
  AAVB74_RS06170 (AAVB74_06170) comX 1189500..1189721 (+) 222 WP_014480704.1 competence pheromone ComX -
  AAVB74_RS06175 (AAVB74_06175) comP 1189737..1192049 (+) 2313 WP_213418792.1 histidine kinase Regulator
  AAVB74_RS06180 (AAVB74_06180) comA 1192130..1192774 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AAVB74_RS06185 (AAVB74_06185) yuxO 1192793..1193173 (+) 381 WP_014477831.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=995438 AAVB74_RS06160 WP_003220708.1 1188310..1188450(+) (degQ) [Bacillus subtilis strain FUA2232]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=995438 AAVB74_RS06160 WP_003220708.1 1188310..1188450(+) (degQ) [Bacillus subtilis strain FUA2232]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment