Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AAYR27_RS08410 Genome accession   NZ_CP154912
Coordinates   1677495..1677635 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain FUA2118     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1672495..1682635
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAYR27_RS08385 (AAYR27_08385) - 1672725..1673132 (+) 408 WP_034282575.1 YueI family protein -
  AAYR27_RS08390 (AAYR27_08390) - 1673193..1673744 (+) 552 WP_305933760.1 isochorismatase family cysteine hydrolase -
  AAYR27_RS08395 (AAYR27_08395) - 1673822..1675233 (+) 1412 Protein_1602 nicotinate phosphoribosyltransferase -
  AAYR27_RS08400 (AAYR27_08400) - 1675371..1676597 (+) 1227 WP_024423326.1 HDOD domain-containing protein -
  AAYR27_RS08405 (AAYR27_08405) - 1676633..1676989 (-) 357 WP_101676437.1 inner spore coat protein -
  AAYR27_RS08410 (AAYR27_08410) degQ 1677495..1677635 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  AAYR27_RS08415 (AAYR27_08415) - 1677787..1678710 (+) 924 WP_065215228.1 polyprenyl synthetase family protein -
  AAYR27_RS08420 (AAYR27_08420) comX 1678688..1678861 (+) 174 WP_046313343.1 competence pheromone ComX -
  AAYR27_RS08425 (AAYR27_08425) comP 1678875..1681166 (+) 2292 WP_345831979.1 ATP-binding protein Regulator
  AAYR27_RS08430 (AAYR27_08430) comA 1681247..1681888 (+) 642 WP_101676435.1 response regulator transcription factor Regulator
  AAYR27_RS08435 (AAYR27_08435) - 1681912..1682301 (+) 390 WP_024423321.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=995239 AAYR27_RS08410 WP_003213123.1 1677495..1677635(+) (degQ) [Bacillus safensis strain FUA2118]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=995239 AAYR27_RS08410 WP_003213123.1 1677495..1677635(+) (degQ) [Bacillus safensis strain FUA2118]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment