Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AAVD42_RS07635 Genome accession   NZ_CP154908
Coordinates   1241680..1241820 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain FUA2116     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1236680..1246820
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVD42_RS07610 (AAVD42_07610) - 1237015..1237404 (-) 390 WP_106066313.1 hotdog fold thioesterase -
  AAVD42_RS07615 (AAVD42_07615) comA 1237428..1238069 (-) 642 WP_058013793.1 response regulator transcription factor Regulator
  AAVD42_RS07620 (AAVD42_07620) comP 1238150..1240441 (-) 2292 WP_345808100.1 ATP-binding protein Regulator
  AAVD42_RS07625 (AAVD42_07625) comX 1240448..1240627 (-) 180 WP_345808101.1 competence pheromone ComX -
  AAVD42_RS07630 (AAVD42_07630) - 1240605..1241528 (-) 924 WP_345808102.1 polyprenyl synthetase family protein -
  AAVD42_RS07635 (AAVD42_07635) degQ 1241680..1241820 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  AAVD42_RS07640 (AAVD42_07640) - 1242326..1242679 (+) 354 WP_345808103.1 inner spore coat protein -
  AAVD42_RS07645 (AAVD42_07645) - 1242710..1243936 (-) 1227 WP_106066310.1 HDOD domain-containing protein -
  AAVD42_RS07650 (AAVD42_07650) - 1244078..1245487 (-) 1410 WP_345808421.1 nicotinate phosphoribosyltransferase -
  AAVD42_RS07655 (AAVD42_07655) - 1245565..1246116 (-) 552 WP_012011112.1 isochorismatase family cysteine hydrolase -
  AAVD42_RS07660 (AAVD42_07660) - 1246177..1246584 (-) 408 WP_345808104.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=995115 AAVD42_RS07635 WP_003213123.1 1241680..1241820(-) (degQ) [Bacillus pumilus strain FUA2116]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=995115 AAVD42_RS07635 WP_003213123.1 1241680..1241820(-) (degQ) [Bacillus pumilus strain FUA2116]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment