Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   AAVC22_RS19695 Genome accession   NZ_CP154902
Coordinates   3883932..3884108 (-) Length   58 a.a.
NCBI ID   WP_023855184.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain FUA2150     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3878932..3889108
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAVC22_RS19650 (AAVC22_19655) comGE 3879262..3879609 (+) 348 WP_025811161.1 competence type IV pilus minor pilin ComGE -
  AAVC22_RS19655 (AAVC22_19660) comGF 3879524..3880006 (+) 483 WP_230588654.1 competence type IV pilus minor pilin ComGF -
  AAVC22_RS19660 (AAVC22_19665) comGG 3880018..3880383 (+) 366 WP_025811163.1 competence type IV pilus minor pilin ComGG -
  AAVC22_RS19665 (AAVC22_19670) - 3880472..3880654 (+) 183 WP_020452171.1 YqzE family protein -
  AAVC22_RS19670 (AAVC22_19675) - 3880684..3881004 (-) 321 WP_023855188.1 YqzG/YhdC family protein -
  AAVC22_RS19675 (AAVC22_19680) tapA 3881282..3882010 (+) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  AAVC22_RS19680 (AAVC22_19685) - 3882007..3882591 (+) 585 WP_035338370.1 signal peptidase I -
  AAVC22_RS19685 (AAVC22_19690) - 3882664..3883458 (+) 795 WP_020452167.1 TasA family protein -
  AAVC22_RS19690 (AAVC22_19695) sinR 3883563..3883898 (-) 336 WP_023855185.1 helix-turn-helix domain-containing protein Regulator
  AAVC22_RS19695 (AAVC22_19700) sinI 3883932..3884108 (-) 177 WP_023855184.1 anti-repressor SinI family protein Regulator
  AAVC22_RS19700 (AAVC22_19705) - 3884299..3885093 (-) 795 WP_020452164.1 YqhG family protein -
  AAVC22_RS19705 (AAVC22_19710) - 3885100..3886779 (-) 1680 WP_020452163.1 SNF2-related protein -
  AAVC22_RS19710 (AAVC22_19715) gcvT 3887374..3888468 (+) 1095 WP_035338369.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6709.46 Da        Isoelectric Point: 4.5938

>NTDB_id=995034 AAVC22_RS19695 WP_023855184.1 3883932..3884108(-) (sinI) [Bacillus paralicheniformis strain FUA2150]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLGEKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=995034 AAVC22_RS19695 WP_023855184.1 3883932..3884108(-) (sinI) [Bacillus paralicheniformis strain FUA2150]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTGAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5

Multiple sequence alignment