Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   EW021_RS00615 Genome accession   NZ_LR130236
Coordinates   98443..98727 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain 5448 isolate 5448     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 93443..103727
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EW021_RS00590 - 95389..95754 (+) 366 WP_002986560.1 DUF1033 family protein -
  EW021_RS00595 comGA 95847..96785 (+) 939 WP_010921798.1 competence type IV pilus ATPase ComGA Machinery gene
  EW021_RS00600 comGB 96721..97755 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  EW021_RS00605 comGC 97757..98083 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  EW021_RS00610 comGD 98058..98486 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  EW021_RS00615 comGE 98443..98727 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  EW021_RS00620 comGF 98720..99154 (+) 435 WP_010921800.1 competence type IV pilus minor pilin ComGF Machinery gene
  EW021_RS00625 comGG 99138..99464 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  EW021_RS00630 comGH 99562..100515 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  EW021_RS00635 - 100574..101770 (+) 1197 WP_010921803.1 acetate kinase -
  EW021_RS00640 - 101957..102265 (+) 309 WP_010921804.1 hypothetical protein -
  EW021_RS00645 proC 102348..103118 (-) 771 WP_010921805.1 pyrroline-5-carboxylate reductase -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=994093 EW021_RS00615 WP_002987779.1 98443..98727(+) (comGE) [Streptococcus pyogenes strain 5448 isolate 5448]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=994093 EW021_RS00615 WP_002987779.1 98443..98727(+) (comGE) [Streptococcus pyogenes strain 5448 isolate 5448]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA

Domains

Predicted by InterProScan.

Type II secretory pathway pseudopilin (ComGE)

(12-93)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383