Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AAHT66_RS11970 Genome accession   NZ_CP154441
Coordinates   2296370..2296744 (+) Length   124 a.a.
NCBI ID   WP_202327198.1    Uniprot ID   -
Organism   Bacillus inaquosorum strain XN303     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2291370..2301744
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAHT66_RS11935 (AAHT66_11935) - 2292178..2292588 (+) 411 WP_087990705.1 CBS domain-containing protein -
  AAHT66_RS11940 (AAHT66_11940) comGA 2292804..2293874 (+) 1071 WP_087990704.1 competence protein ComGA Machinery gene
  AAHT66_RS11945 (AAHT66_11945) comGB 2293861..2294898 (+) 1038 WP_202327196.1 competence type IV pilus assembly protein ComGB Machinery gene
  AAHT66_RS11950 (AAHT66_11950) comGC 2294912..2295208 (+) 297 WP_087990702.1 comG operon protein ComGC Machinery gene
  AAHT66_RS11955 (AAHT66_11955) comGD 2295198..2295629 (+) 432 WP_087990701.1 competence type IV pilus minor pilin ComGD Machinery gene
  AAHT66_RS11960 (AAHT66_11960) comGE 2295613..2295960 (+) 348 WP_087990700.1 competence type IV pilus minor pilin ComGE Machinery gene
  AAHT66_RS11965 (AAHT66_11965) comGF 2295962..2296369 (+) 408 WP_284690388.1 competence type IV pilus minor pilin ComGF Machinery gene
  AAHT66_RS11970 (AAHT66_11970) comGG 2296370..2296744 (+) 375 WP_202327198.1 competence type IV pilus minor pilin ComGG Machinery gene
  AAHT66_RS11975 (AAHT66_11975) - 2296813..2296992 (+) 180 WP_087990697.1 YqzE family protein -
  AAHT66_RS11980 (AAHT66_11980) - 2297036..2297365 (-) 330 WP_087990817.1 YqzG/YhdC family protein -
  AAHT66_RS11985 (AAHT66_11985) tapA 2297627..2298388 (+) 762 WP_202327199.1 amyloid fiber anchoring/assembly protein TapA -
  AAHT66_RS11990 (AAHT66_11990) - 2298372..2298944 (+) 573 WP_087990816.1 signal peptidase I SipW -
  AAHT66_RS11995 (AAHT66_11995) tasA 2299007..2299792 (+) 786 WP_087990695.1 biofilm matrix protein TasA -
  AAHT66_RS12000 (AAHT66_12000) sinR 2299884..2300219 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AAHT66_RS12005 (AAHT66_12005) sinI 2300253..2300426 (-) 174 WP_087990694.1 anti-repressor SinI Regulator
  AAHT66_RS12010 (AAHT66_12010) - 2300610..2301404 (-) 795 WP_253268418.1 YqhG family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14364.44 Da        Isoelectric Point: 8.8102

>NTDB_id=993365 AAHT66_RS11970 WP_202327198.1 2296370..2296744(+) (comGG) [Bacillus inaquosorum strain XN303]
MYRTRGFVYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKEFYTGENLLQNGALLSIRHILEQRKGQKGSQQFTYGQVS
YDIHDTSIKEQKEINLKAMTESGTERTAQLVFDQKQKQLLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=993365 AAHT66_RS11970 WP_202327198.1 2296370..2296744(+) (comGG) [Bacillus inaquosorum strain XN303]
ATGTACCGCACGAGAGGGTTTGTTTATCCCGCTGTTCTTTTTGTATCCGCGCTTGTACTGCTGATCGTGAACTTTACTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTTTACACAGGAGAGAATTTACTTCAGAATGGCG
CGCTTTTGTCTATTCGGCATATTCTTGAGCAACGGAAAGGCCAAAAGGGTTCACAGCAGTTTACATATGGGCAGGTTTCT
TATGACATTCATGATACATCGATAAAAGAGCAAAAAGAAATCAATTTAAAAGCCATGACGGAGTCGGGAACAGAAAGAAC
TGCACAGCTAGTGTTTGATCAAAAACAGAAACAACTGCTGAGCTGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

84.677

100

0.847

Multiple sequence alignment