Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AAHT66_RS08625 Genome accession   NZ_CP154441
Coordinates   1668036..1668176 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus inaquosorum strain XN303     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1663036..1673176
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAHT66_RS08595 (AAHT66_08595) - 1663332..1663730 (+) 399 WP_087993282.1 YueI family protein -
  AAHT66_RS08600 (AAHT66_08600) - 1663827..1664378 (+) 552 WP_087993281.1 cysteine hydrolase family protein -
  AAHT66_RS08605 (AAHT66_08605) - 1664394..1665860 (+) 1467 WP_333516464.1 nicotinate phosphoribosyltransferase -
  AAHT66_RS08610 (AAHT66_08610) pdeH 1666003..1667232 (+) 1230 WP_087993279.1 cyclic di-GMP phosphodiesterase -
  AAHT66_RS08615 (AAHT66_08615) - 1667211..1667576 (-) 366 WP_087993278.1 hypothetical protein -
  AAHT66_RS08620 (AAHT66_08620) - 1667609..1667746 (+) 138 WP_176365307.1 hypothetical protein -
  AAHT66_RS08625 (AAHT66_08625) degQ 1668036..1668176 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AAHT66_RS08630 (AAHT66_08630) - 1668361..1669221 (+) 861 WP_087993340.1 polyprenyl synthetase family protein -
  AAHT66_RS08635 (AAHT66_08635) comX 1669236..1669397 (+) 162 WP_003241045.1 competence pheromone ComX -
  AAHT66_RS08640 (AAHT66_08640) comP 1669405..1671702 (+) 2298 WP_202328143.1 histidine kinase Regulator
  AAHT66_RS08645 (AAHT66_08645) comA 1671783..1672427 (+) 645 WP_202328144.1 two-component system response regulator ComA Regulator
  AAHT66_RS08650 (AAHT66_08650) - 1672446..1672826 (+) 381 WP_253268529.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=993343 AAHT66_RS08625 WP_003220708.1 1668036..1668176(+) (degQ) [Bacillus inaquosorum strain XN303]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=993343 AAHT66_RS08625 WP_003220708.1 1668036..1668176(+) (degQ) [Bacillus inaquosorum strain XN303]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment