Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AAC934_RS12640 Genome accession   NZ_CP152362
Coordinates   2472728..2472901 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain LP     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2467728..2477901
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAC934_RS12625 (AAC934_12625) gcvT 2468527..2469615 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  AAC934_RS12630 (AAC934_12630) yqhH 2470057..2471730 (+) 1674 WP_003230203.1 SNF2-related protein -
  AAC934_RS12635 (AAC934_12635) yqhG 2471751..2472545 (+) 795 WP_015714249.1 YqhG family protein -
  AAC934_RS12640 (AAC934_12640) sinI 2472728..2472901 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  AAC934_RS12645 (AAC934_12645) sinR 2472935..2473270 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AAC934_RS12650 (AAC934_12650) tasA 2473363..2474148 (-) 786 WP_015714250.1 biofilm matrix protein TasA -
  AAC934_RS12655 (AAC934_12655) sipW 2474212..2474784 (-) 573 WP_003230181.1 signal peptidase I -
  AAC934_RS12660 (AAC934_12660) tapA 2474768..2475529 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  AAC934_RS12665 (AAC934_12665) yqzG 2475801..2476127 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AAC934_RS12670 (AAC934_12670) spoIIT 2476169..2476348 (-) 180 WP_014480252.1 YqzE family protein -
  AAC934_RS12675 (AAC934_12675) comGG 2476419..2476793 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  AAC934_RS12680 (AAC934_12680) comGF 2476794..2477177 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  AAC934_RS12685 (AAC934_12685) comGE 2477203..2477550 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=988614 AAC934_RS12640 WP_003230187.1 2472728..2472901(+) (sinI) [Bacillus subtilis strain LP]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=988614 AAC934_RS12640 WP_003230187.1 2472728..2472901(+) (sinI) [Bacillus subtilis strain LP]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment