Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHH29_RS03620 Genome accession   NZ_CP152048
Coordinates   670375..670515 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL K6-0046     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 665375..675515
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHH29_RS03595 (MHH29_03595) - 665697..666086 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  MHH29_RS03600 (MHH29_03600) comA 666110..666751 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  MHH29_RS03605 (MHH29_03605) comP 666832..669138 (-) 2307 WP_268361539.1 ATP-binding protein Regulator
  MHH29_RS03610 (MHH29_03610) comX 669152..669322 (-) 171 WP_034317154.1 competence pheromone ComX -
  MHH29_RS03615 (MHH29_03615) - 669300..670223 (-) 924 WP_008345863.1 polyprenyl synthetase family protein -
  MHH29_RS03620 (MHH29_03620) degQ 670375..670515 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MHH29_RS03625 (MHH29_03625) - 671021..671374 (+) 354 WP_342494939.1 inner spore coat protein -
  MHH29_RS03630 (MHH29_03630) - 671411..672637 (-) 1227 WP_342495500.1 HDOD domain-containing protein -
  MHH29_RS03635 (MHH29_03635) - 672778..674187 (-) 1410 WP_230677047.1 nicotinate phosphoribosyltransferase -
  MHH29_RS03640 (MHH29_03640) - 674265..674816 (-) 552 WP_025207909.1 isochorismatase family cysteine hydrolase -
  MHH29_RS03645 (MHH29_03645) - 674877..675284 (-) 408 WP_046344389.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=986780 MHH29_RS03620 WP_003213123.1 670375..670515(-) (degQ) [Bacillus sp. FSL K6-0046]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=986780 MHH29_RS03620 WP_003213123.1 670375..670515(-) (degQ) [Bacillus sp. FSL K6-0046]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment