Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   MHB69_RS15230 Genome accession   NZ_CP152043
Coordinates   2893233..2893373 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL K6-0994     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2888233..2898373
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHB69_RS15205 (MHB69_15205) - 2888555..2888944 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  MHB69_RS15210 (MHB69_15210) comA 2888968..2889609 (-) 642 WP_034282566.1 response regulator transcription factor Regulator
  MHB69_RS15215 (MHB69_15215) comP 2889690..2891996 (-) 2307 WP_339240207.1 ATP-binding protein Regulator
  MHB69_RS15220 (MHB69_15220) comX 2892010..2892189 (-) 180 WP_313960228.1 competence pheromone ComX -
  MHB69_RS15225 (MHB69_15225) - 2892158..2893081 (-) 924 WP_342495740.1 polyprenyl synthetase family protein -
  MHB69_RS15230 (MHB69_15230) degQ 2893233..2893373 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MHB69_RS15235 (MHB69_15235) - 2893879..2894235 (+) 357 WP_061110019.1 hypothetical protein -
  MHB69_RS15240 (MHB69_15240) - 2894271..2895497 (-) 1227 WP_061110020.1 HDOD domain-containing protein -
  MHB69_RS15245 (MHB69_15245) - 2895635..2897107 (-) 1473 WP_041115814.1 nicotinate phosphoribosyltransferase -
  MHB69_RS15250 (MHB69_15250) - 2897125..2897676 (-) 552 WP_024425949.1 isochorismatase family cysteine hydrolase -
  MHB69_RS15255 (MHB69_15255) - 2897737..2898144 (-) 408 WP_034282575.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=986564 MHB69_RS15230 WP_003213123.1 2893233..2893373(-) (degQ) [Bacillus sp. FSL K6-0994]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=986564 MHB69_RS15230 WP_003213123.1 2893233..2893373(-) (degQ) [Bacillus sp. FSL K6-0994]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696


Multiple sequence alignment