Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NYE62_RS15920 Genome accession   NZ_CP152037
Coordinates   3207174..3207314 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus sp. FSL K6-2861     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3202174..3212314
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE62_RS15895 (NYE62_15895) - 3202493..3202876 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  NYE62_RS15900 (NYE62_15900) comA 3202898..3203542 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  NYE62_RS15905 (NYE62_15905) comP 3203623..3205929 (-) 2307 WP_342497052.1 histidine kinase Regulator
  NYE62_RS15910 (NYE62_15910) comX 3205952..3206128 (-) 177 WP_013353396.1 competence pheromone ComX -
  NYE62_RS15915 (NYE62_15915) - 3206147..3207022 (-) 876 WP_144664417.1 polyprenyl synthetase family protein -
  NYE62_RS15920 (NYE62_15920) degQ 3207174..3207314 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  NYE62_RS15925 (NYE62_15925) - 3207780..3208121 (+) 342 WP_144463936.1 hypothetical protein -
  NYE62_RS15930 (NYE62_15930) - 3208128..3209351 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  NYE62_RS15935 (NYE62_15935) - 3209481..3210947 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  NYE62_RS15940 (NYE62_15940) - 3210965..3211516 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  NYE62_RS15945 (NYE62_15945) - 3211613..3212011 (-) 399 WP_061862533.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=986235 NYE62_RS15920 WP_003152043.1 3207174..3207314(-) (degQ) [Bacillus sp. FSL K6-2861]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=986235 NYE62_RS15920 WP_003152043.1 3207174..3207314(-) (degQ) [Bacillus sp. FSL K6-2861]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment