Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   NYE62_RS02035 Genome accession   NZ_CP152037
Coordinates   433806..433925 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus sp. FSL K6-2861     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 428806..438925
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE62_RS02020 (NYE62_02020) - 430418..431101 (+) 684 WP_007410267.1 response regulator transcription factor -
  NYE62_RS02025 (NYE62_02025) - 431088..432521 (+) 1434 WP_179288762.1 HAMP domain-containing sensor histidine kinase -
  NYE62_RS02030 (NYE62_02030) rapC 432674..433822 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  NYE62_RS02035 (NYE62_02035) phrC 433806..433925 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  NYE62_RS02040 (NYE62_02040) - 434073..434168 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  NYE62_RS02045 (NYE62_02045) - 434263..435627 (-) 1365 WP_095352403.1 aspartate kinase -
  NYE62_RS02050 (NYE62_02050) ceuB 436041..436994 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  NYE62_RS02055 (NYE62_02055) - 436984..437931 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  NYE62_RS02060 (NYE62_02060) - 437925..438683 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=986184 NYE62_RS02035 WP_003156334.1 433806..433925(+) (phrC) [Bacillus sp. FSL K6-2861]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=986184 NYE62_RS02035 WP_003156334.1 433806..433925(+) (phrC) [Bacillus sp. FSL K6-2861]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment