Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | NYE42_RS12720 | Genome accession | NZ_CP152036 |
| Coordinates | 2613465..2613638 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus sp. FSL K6-2865 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2608465..2618638
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYE42_RS12705 (NYE42_12685) | gcvT | 2609278..2610378 (-) | 1101 | WP_332275795.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| NYE42_RS12710 (NYE42_12690) | - | 2610802..2612472 (+) | 1671 | WP_063094778.1 | SNF2-related protein | - |
| NYE42_RS12715 (NYE42_12695) | - | 2612494..2613288 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| NYE42_RS12720 (NYE42_12700) | sinI | 2613465..2613638 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| NYE42_RS12725 (NYE42_12705) | sinR | 2613672..2614007 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| NYE42_RS12730 (NYE42_12710) | tasA | 2614055..2614840 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| NYE42_RS12735 (NYE42_12715) | sipW | 2614905..2615489 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| NYE42_RS12740 (NYE42_12720) | tapA | 2615461..2616132 (-) | 672 | WP_095352946.1 | amyloid fiber anchoring/assembly protein TapA | - |
| NYE42_RS12745 (NYE42_12725) | - | 2616391..2616720 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| NYE42_RS12750 (NYE42_12730) | - | 2616760..2616939 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| NYE42_RS12755 (NYE42_12735) | comGG | 2616996..2617373 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| NYE42_RS12760 (NYE42_12740) | comGF | 2617374..2617874 (-) | 501 | WP_260854721.1 | competence type IV pilus minor pilin ComGF | - |
| NYE42_RS12765 (NYE42_12745) | comGE | 2617783..2618097 (-) | 315 | WP_352426500.1 | competence type IV pilus minor pilin ComGE | - |
| NYE42_RS12770 (NYE42_12750) | comGD | 2618081..2618518 (-) | 438 | WP_015417817.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=986137 NYE42_RS12720 WP_003153105.1 2613465..2613638(+) (sinI) [Bacillus sp. FSL K6-2865]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=986137 NYE42_RS12720 WP_003153105.1 2613465..2613638(+) (sinI) [Bacillus sp. FSL K6-2865]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |