Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHB83_RS00585 Genome accession   NZ_CP152034
Coordinates   100622..100762 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL K6-3149     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 95622..105762
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHB83_RS00560 (MHB83_00560) - 95963..96352 (-) 390 WP_340866485.1 hotdog fold thioesterase -
  MHB83_RS00565 (MHB83_00565) comA 96376..97017 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  MHB83_RS00570 (MHB83_00570) comP 97098..99383 (-) 2286 WP_253622277.1 ATP-binding protein Regulator
  MHB83_RS00575 (MHB83_00575) comX 99390..99578 (-) 189 WP_342496544.1 competence pheromone ComX -
  MHB83_RS00580 (MHB83_00580) - 99547..100470 (-) 924 WP_322000331.1 polyprenyl synthetase family protein -
  MHB83_RS00585 (MHB83_00585) degQ 100622..100762 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MHB83_RS00590 (MHB83_00590) - 101268..101621 (+) 354 WP_050944043.1 hypothetical protein -
  MHB83_RS00595 (MHB83_00595) - 101652..102878 (-) 1227 WP_050944044.1 HDOD domain-containing protein -
  MHB83_RS00600 (MHB83_00600) - 103019..104428 (-) 1410 WP_229200437.1 nicotinate phosphoribosyltransferase -
  MHB83_RS00605 (MHB83_00605) - 104506..105057 (-) 552 WP_003213138.1 isochorismatase family cysteine hydrolase -
  MHB83_RS00610 (MHB83_00610) - 105118..105525 (-) 408 WP_050944045.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=985978 MHB83_RS00585 WP_003213123.1 100622..100762(-) (degQ) [Bacillus sp. FSL K6-3149]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=985978 MHB83_RS00585 WP_003213123.1 100622..100762(-) (degQ) [Bacillus sp. FSL K6-3149]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment