Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHI60_RS11735 Genome accession   NZ_CP152032
Coordinates   2330832..2330972 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL K6-3200     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2325832..2335972
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHI60_RS11710 (MHI60_11710) - 2326063..2326470 (+) 408 WP_144483396.1 YueI family protein -
  MHI60_RS11715 (MHI60_11715) - 2326531..2327082 (+) 552 WP_095409470.1 isochorismatase family cysteine hydrolase -
  MHI60_RS11720 (MHI60_11720) - 2327160..2328572 (+) 1413 WP_342502688.1 nicotinate phosphoribosyltransferase -
  MHI60_RS11725 (MHI60_11725) - 2328710..2329936 (+) 1227 WP_144484294.1 HDOD domain-containing protein -
  MHI60_RS11730 (MHI60_11730) - 2329970..2330326 (-) 357 WP_144483390.1 inner spore coat protein -
  MHI60_RS11735 (MHI60_11735) degQ 2330832..2330972 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MHI60_RS11740 (MHI60_11740) - 2331124..2332038 (+) 915 WP_144483387.1 polyprenyl synthetase family protein -
  MHI60_RS11745 (MHI60_11745) comX 2332035..2332202 (+) 168 WP_186318690.1 competence pheromone ComX -
  MHI60_RS11750 (MHI60_11750) comP 2332260..2334572 (+) 2313 WP_144483383.1 ATP-binding protein Regulator
  MHI60_RS11755 (MHI60_11755) comA 2334653..2335294 (+) 642 WP_144472265.1 response regulator transcription factor Regulator
  MHI60_RS11760 (MHI60_11760) - 2335318..2335707 (+) 390 WP_095409463.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=985893 MHI60_RS11735 WP_003213123.1 2330832..2330972(+) (degQ) [Bacillus sp. FSL K6-3200]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=985893 MHI60_RS11735 WP_003213123.1 2330832..2330972(+) (degQ) [Bacillus sp. FSL K6-3200]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment