Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHH54_RS14665 Genome accession   NZ_CP152030
Coordinates   2872030..2872170 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL K6-4563     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2867030..2877170
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHH54_RS14640 (MHH54_14640) - 2867365..2867754 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  MHH54_RS14645 (MHH54_14645) comA 2867778..2868419 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  MHH54_RS14650 (MHH54_14650) comP 2868500..2870791 (-) 2292 WP_106036183.1 ATP-binding protein Regulator
  MHH54_RS14655 (MHH54_14655) comX 2870798..2870977 (-) 180 WP_034620107.1 competence pheromone ComX -
  MHH54_RS14660 (MHH54_14660) - 2870955..2871878 (-) 924 WP_003212977.1 polyprenyl synthetase family protein -
  MHH54_RS14665 (MHH54_14665) degQ 2872030..2872170 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MHH54_RS14670 (MHH54_14670) - 2872676..2873029 (+) 354 WP_034620108.1 hypothetical protein -
  MHH54_RS14675 (MHH54_14675) - 2873060..2874286 (-) 1227 WP_106032245.1 HDOD domain-containing protein -
  MHH54_RS14680 (MHH54_14680) - 2874426..2875895 (-) 1470 WP_003212630.1 nicotinate phosphoribosyltransferase -
  MHH54_RS14685 (MHH54_14685) - 2875913..2876464 (-) 552 WP_003213138.1 isochorismatase family cysteine hydrolase -
  MHH54_RS14690 (MHH54_14690) - 2876525..2876932 (-) 408 WP_050944045.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=985809 MHH54_RS14665 WP_003213123.1 2872030..2872170(-) (degQ) [Bacillus sp. FSL K6-4563]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=985809 MHH54_RS14665 WP_003213123.1 2872030..2872170(-) (degQ) [Bacillus sp. FSL K6-4563]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment