Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHI08_RS14565 Genome accession   NZ_CP152022
Coordinates   2814587..2814727 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL M7-0791     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2809587..2819727
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHI08_RS14540 (MHI08_14540) - 2809859..2810248 (-) 390 WP_047203310.1 hotdog fold thioesterase -
  MHI08_RS14545 (MHI08_14545) comA 2810272..2810913 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  MHI08_RS14550 (MHI08_14550) comP 2810994..2813306 (-) 2313 WP_107163122.1 ATP-binding protein Regulator
  MHI08_RS14555 (MHI08_14555) comX 2813354..2813524 (-) 171 WP_181286101.1 competence pheromone ComX -
  MHI08_RS14560 (MHI08_14560) - 2813521..2814435 (-) 915 WP_269773583.1 polyprenyl synthetase family protein -
  MHI08_RS14565 (MHI08_14565) degQ 2814587..2814727 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MHI08_RS14570 (MHI08_14570) - 2815233..2815589 (+) 357 WP_052773115.1 hypothetical protein -
  MHI08_RS14575 (MHI08_14575) - 2815625..2816851 (-) 1227 WP_024425947.1 HDOD domain-containing protein -
  MHI08_RS14580 (MHI08_14580) - 2816989..2818461 (-) 1473 WP_024425948.1 nicotinate phosphoribosyltransferase -
  MHI08_RS14585 (MHI08_14585) - 2818479..2819030 (-) 552 WP_087978057.1 isochorismatase family cysteine hydrolase -
  MHI08_RS14590 (MHI08_14590) - 2819091..2819498 (-) 408 WP_047203314.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=985346 MHI08_RS14565 WP_003213123.1 2814587..2814727(-) (degQ) [Bacillus sp. FSL M7-0791]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=985346 MHI08_RS14565 WP_003213123.1 2814587..2814727(-) (degQ) [Bacillus sp. FSL M7-0791]
ATGGAAAAGTATGAAATCGAAGAGCTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment