Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NYE68_RS16950 Genome accession   NZ_CP152012
Coordinates   3349231..3349371 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus sp. FSL R5-0447     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3344231..3354371
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE68_RS16925 (NYE68_16925) - 3344558..3344941 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  NYE68_RS16930 (NYE68_16930) comA 3344963..3345607 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  NYE68_RS16935 (NYE68_16935) comP 3345688..3347994 (-) 2307 WP_324636435.1 sensor histidine kinase Regulator
  NYE68_RS16940 (NYE68_16940) comX 3348013..3348189 (-) 177 WP_015240484.1 competence pheromone ComX -
  NYE68_RS16945 (NYE68_16945) - 3348204..3349079 (-) 876 WP_122504180.1 polyprenyl synthetase family protein -
  NYE68_RS16950 (NYE68_16950) degQ 3349231..3349371 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  NYE68_RS16955 (NYE68_16955) - 3349834..3350175 (+) 342 WP_007408677.1 hypothetical protein -
  NYE68_RS16960 (NYE68_16960) - 3350182..3351405 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  NYE68_RS16965 (NYE68_16965) - 3351535..3353001 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  NYE68_RS16970 (NYE68_16970) - 3353019..3353570 (-) 552 WP_324636434.1 isochorismatase family cysteine hydrolase -
  NYE68_RS16975 (NYE68_16975) - 3353667..3354065 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=984848 NYE68_RS16950 WP_003152043.1 3349231..3349371(-) (degQ) [Bacillus sp. FSL R5-0447]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=984848 NYE68_RS16950 WP_003152043.1 3349231..3349371(-) (degQ) [Bacillus sp. FSL R5-0447]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment