Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | NYE68_RS13380 | Genome accession | NZ_CP152012 |
| Coordinates | 2703064..2703237 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus sp. FSL R5-0447 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2698064..2708237
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYE68_RS13365 (NYE68_13365) | gcvT | 2698877..2699977 (-) | 1101 | WP_031378949.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| NYE68_RS13370 (NYE68_13370) | - | 2700401..2702071 (+) | 1671 | WP_031378948.1 | SNF2-related protein | - |
| NYE68_RS13375 (NYE68_13375) | - | 2702093..2702887 (+) | 795 | WP_156240427.1 | YqhG family protein | - |
| NYE68_RS13380 (NYE68_13380) | sinI | 2703064..2703237 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| NYE68_RS13385 (NYE68_13385) | sinR | 2703271..2703606 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| NYE68_RS13390 (NYE68_13390) | - | 2703654..2704439 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| NYE68_RS13395 (NYE68_13395) | - | 2704504..2705088 (-) | 585 | WP_015240205.1 | signal peptidase I | - |
| NYE68_RS13400 (NYE68_13400) | tapA | 2705060..2705731 (-) | 672 | WP_324636720.1 | amyloid fiber anchoring/assembly protein TapA | - |
| NYE68_RS13405 (NYE68_13405) | - | 2705990..2706319 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| NYE68_RS13410 (NYE68_13410) | - | 2706359..2706538 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| NYE68_RS13415 (NYE68_13415) | comGG | 2706595..2706972 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| NYE68_RS13420 (NYE68_13420) | comGF | 2706973..2707368 (-) | 396 | WP_324636718.1 | competence type IV pilus minor pilin ComGF | - |
| NYE68_RS13425 (NYE68_13425) | comGE | 2707382..2707696 (-) | 315 | WP_324636717.1 | competence type IV pilus minor pilin ComGE | - |
| NYE68_RS13430 (NYE68_13430) | comGD | 2707680..2708117 (-) | 438 | WP_015417817.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=984827 NYE68_RS13380 WP_003153105.1 2703064..2703237(+) (sinI) [Bacillus sp. FSL R5-0447]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=984827 NYE68_RS13380 WP_003153105.1 2703064..2703237(+) (sinI) [Bacillus sp. FSL R5-0447]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |