Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | NYE36_RS13045 | Genome accession | NZ_CP152011 |
| Coordinates | 2670402..2670575 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus sp. FSL R5-0593 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2665402..2675575
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYE36_RS13030 (NYE36_13030) | gcvT | 2666215..2667315 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| NYE36_RS13035 (NYE36_13035) | - | 2667739..2669409 (+) | 1671 | WP_199022041.1 | SNF2-related protein | - |
| NYE36_RS13040 (NYE36_13040) | - | 2669431..2670225 (+) | 795 | WP_199022042.1 | YqhG family protein | - |
| NYE36_RS13045 (NYE36_13045) | sinI | 2670402..2670575 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| NYE36_RS13050 (NYE36_13050) | sinR | 2670609..2670944 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| NYE36_RS13055 (NYE36_13055) | - | 2670992..2671777 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| NYE36_RS13060 (NYE36_13060) | - | 2671842..2672426 (-) | 585 | WP_015240205.1 | signal peptidase I | - |
| NYE36_RS13065 (NYE36_13065) | tapA | 2672398..2673069 (-) | 672 | WP_015417813.1 | amyloid fiber anchoring/assembly protein TapA | - |
| NYE36_RS13070 (NYE36_13070) | - | 2673328..2673657 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| NYE36_RS13075 (NYE36_13075) | - | 2673697..2673876 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| NYE36_RS13080 (NYE36_13080) | comGG | 2673933..2674310 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| NYE36_RS13085 (NYE36_13085) | comGF | 2674311..2674811 (-) | 501 | WP_254922226.1 | competence type IV pilus minor pilin ComGF | - |
| NYE36_RS13090 (NYE36_13090) | comGE | 2674720..2675034 (-) | 315 | WP_094032244.1 | competence type IV pilus minor pilin ComGE | - |
| NYE36_RS13095 (NYE36_13095) | comGD | 2675018..2675455 (-) | 438 | WP_094032243.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=984753 NYE36_RS13045 WP_003153105.1 2670402..2670575(+) (sinI) [Bacillus sp. FSL R5-0593]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=984753 NYE36_RS13045 WP_003153105.1 2670402..2670575(+) (sinI) [Bacillus sp. FSL R5-0593]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |