Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MKY18_RS14615 Genome accession   NZ_CP152010
Coordinates   2860931..2861071 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL R7-0672     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2855931..2866071
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKY18_RS14590 (MKY18_14590) - 2856253..2856642 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  MKY18_RS14595 (MKY18_14595) comA 2856666..2857307 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  MKY18_RS14600 (MKY18_14600) comP 2857388..2859694 (-) 2307 WP_044140820.1 ATP-binding protein Regulator
  MKY18_RS14605 (MKY18_14605) comX 2859708..2859878 (-) 171 WP_012011107.1 competence pheromone ComX -
  MKY18_RS14610 (MKY18_14610) - 2859856..2860779 (-) 924 WP_106029260.1 polyprenyl synthetase family protein -
  MKY18_RS14615 (MKY18_14615) degQ 2860931..2861071 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MKY18_RS14620 (MKY18_14620) - 2861577..2861930 (+) 354 WP_185106862.1 inner spore coat protein -
  MKY18_RS14625 (MKY18_14625) - 2861961..2863187 (-) 1227 WP_106032245.1 HDOD domain-containing protein -
  MKY18_RS14630 (MKY18_14630) - 2863328..2864797 (-) 1470 WP_003212630.1 nicotinate phosphoribosyltransferase -
  MKY18_RS14635 (MKY18_14635) - 2864815..2865366 (-) 552 WP_012011112.1 isochorismatase family cysteine hydrolase -
  MKY18_RS14640 (MKY18_14640) - 2865427..2865834 (-) 408 WP_044140823.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=984701 MKY18_RS14615 WP_003213123.1 2860931..2861071(-) (degQ) [Bacillus sp. FSL R7-0672]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=984701 MKY18_RS14615 WP_003213123.1 2860931..2861071(-) (degQ) [Bacillus sp. FSL R7-0672]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment