Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   MKY76_RS12820 Genome accession   NZ_CP151995
Coordinates   2560310..2560894 (-) Length   194 a.a.
NCBI ID   WP_342556666.1    Uniprot ID   -
Organism   Lysinibacillus sp. FSL P4-0201     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2528399..2577820 2560310..2560894 within 0


Gene organization within MGE regions


Location: 2528399..2577820
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKY76_RS12595 (MKY76_12595) - 2528399..2528656 (-) 258 WP_342556628.1 phage holin -
  MKY76_RS12600 (MKY76_12600) - 2528646..2528933 (-) 288 WP_342556629.1 hypothetical protein -
  MKY76_RS12605 (MKY76_12605) - 2529065..2529316 (-) 252 WP_342556630.1 hypothetical protein -
  MKY76_RS12610 (MKY76_12610) - 2529391..2529546 (-) 156 WP_066037055.1 XkdX family protein -
  MKY76_RS12615 (MKY76_12615) - 2529546..2529767 (-) 222 WP_342556631.1 hypothetical protein -
  MKY76_RS12620 (MKY76_12620) - 2529767..2532325 (-) 2559 WP_342556632.1 sialidase family protein -
  MKY76_RS12625 (MKY76_12625) - 2532328..2532915 (-) 588 WP_342556633.1 hypothetical protein -
  MKY76_RS12630 (MKY76_12630) - 2532920..2533228 (-) 309 WP_342556634.1 hypothetical protein -
  MKY76_RS12635 (MKY76_12635) - 2533225..2533881 (-) 657 WP_342556635.1 putative phage tail protein -
  MKY76_RS12640 (MKY76_12640) - 2533878..2534969 (-) 1092 WP_342556636.1 baseplate J/gp47 family protein -
  MKY76_RS12645 (MKY76_12645) - 2534962..2535378 (-) 417 WP_342556637.1 DUF2634 domain-containing protein -
  MKY76_RS12650 (MKY76_12650) - 2535372..2535812 (-) 441 WP_342556638.1 DUF2577 domain-containing protein -
  MKY76_RS12655 (MKY76_12655) - 2535809..2536774 (-) 966 WP_342556639.1 hypothetical protein -
  MKY76_RS12660 (MKY76_12660) - 2536776..2537474 (-) 699 WP_342556640.1 LysM peptidoglycan-binding domain-containing protein -
  MKY76_RS12665 (MKY76_12665) - 2537471..2539999 (-) 2529 WP_342556641.1 tape measure protein -
  MKY76_RS12670 (MKY76_12670) - 2540041..2540403 (-) 363 WP_342556642.1 hypothetical protein -
  MKY76_RS12675 (MKY76_12675) - 2540521..2540784 (-) 264 WP_342556643.1 hypothetical protein -
  MKY76_RS12680 (MKY76_12680) - 2540950..2541690 (-) 741 WP_342556644.1 ORF6C domain-containing protein -
  MKY76_RS12685 (MKY76_12685) - 2541705..2541965 (-) 261 WP_342556645.1 XRE family transcriptional regulator -
  MKY76_RS12690 (MKY76_12690) - 2542114..2542851 (+) 738 WP_342556646.1 hypothetical protein -
  MKY76_RS12695 (MKY76_12695) - 2543285..2543686 (-) 402 WP_036075119.1 phage portal protein -
  MKY76_RS12700 (MKY76_12700) - 2543701..2544168 (-) 468 WP_205443772.1 phage tail tube protein -
  MKY76_RS12705 (MKY76_12705) - 2544186..2545481 (-) 1296 WP_342556647.1 phage tail sheath subtilisin-like domain-containing protein -
  MKY76_RS12710 (MKY76_12710) - 2545481..2545678 (-) 198 WP_342556648.1 hypothetical protein -
  MKY76_RS12715 (MKY76_12715) - 2545632..2546090 (-) 459 WP_342556649.1 DUF6838 family protein -
  MKY76_RS12720 (MKY76_12720) - 2546083..2546481 (-) 399 WP_342556650.1 HK97 gp10 family phage protein -
  MKY76_RS12725 (MKY76_12725) - 2546481..2546873 (-) 393 WP_342556651.1 hypothetical protein -
  MKY76_RS12730 (MKY76_12730) - 2546875..2547219 (-) 345 WP_342556652.1 hypothetical protein -
  MKY76_RS12735 (MKY76_12735) - 2547231..2547413 (-) 183 WP_342556653.1 hypothetical protein -
  MKY76_RS12740 (MKY76_12740) - 2547426..2548442 (-) 1017 WP_342556654.1 major capsid protein -
  MKY76_RS12745 (MKY76_12745) - 2548472..2548786 (-) 315 WP_342556655.1 hypothetical protein -
  MKY76_RS12750 (MKY76_12750) - 2548799..2549386 (-) 588 WP_342556656.1 phage scaffolding protein -
  MKY76_RS12755 (MKY76_12755) - 2549462..2550475 (-) 1014 WP_342556657.1 minor capsid protein -
  MKY76_RS12760 (MKY76_12760) - 2550468..2551913 (-) 1446 WP_342556658.1 phage portal protein -
  MKY76_RS12765 (MKY76_12765) - 2551923..2553197 (-) 1275 WP_342556659.1 PBSX family phage terminase large subunit -
  MKY76_RS12770 (MKY76_12770) terS 2553190..2554017 (-) 828 WP_342556660.1 phage terminase small subunit -
  MKY76_RS12775 (MKY76_12775) - 2554197..2554463 (-) 267 WP_342556661.1 hypothetical protein -
  MKY76_RS12780 (MKY76_12780) - 2554683..2555237 (-) 555 WP_263081756.1 hypothetical protein -
  MKY76_RS12785 (MKY76_12785) - 2555706..2556191 (-) 486 WP_257522291.1 sigma-70 family RNA polymerase sigma factor -
  MKY76_RS12790 (MKY76_12790) - 2556631..2556918 (+) 288 WP_257522292.1 hydrolase -
  MKY76_RS12795 (MKY76_12795) - 2557381..2557863 (+) 483 Protein_2503 bclA protein -
  MKY76_RS12800 (MKY76_12800) - 2558086..2558631 (+) 546 WP_342556662.1 collagen-like protein -
  MKY76_RS12805 (MKY76_12805) - 2558828..2559571 (-) 744 WP_342556663.1 hypothetical protein -
  MKY76_RS12810 (MKY76_12810) - 2559574..2560119 (-) 546 WP_342556664.1 Holliday junction resolvase RecU -
  MKY76_RS12815 (MKY76_12815) - 2560109..2560297 (-) 189 WP_342556665.1 DUF6011 domain-containing protein -
  MKY76_RS12820 (MKY76_12820) ssbA 2560310..2560894 (-) 585 WP_342556666.1 single-stranded DNA-binding protein Machinery gene
  MKY76_RS12825 (MKY76_12825) - 2560887..2561189 (-) 303 WP_342556667.1 DUF6877 family protein -
  MKY76_RS12830 (MKY76_12830) - 2561176..2562297 (-) 1122 WP_342556668.1 DNA replication protein DnaD -
  MKY76_RS12835 (MKY76_12835) - 2562488..2563207 (-) 720 WP_342556669.1 ERF family protein -
  MKY76_RS12840 (MKY76_12840) - 2563312..2563476 (-) 165 WP_342556670.1 hypothetical protein -
  MKY76_RS12845 (MKY76_12845) - 2563661..2563795 (-) 135 WP_255409617.1 hypothetical protein -
  MKY76_RS12850 (MKY76_12850) - 2563856..2564131 (-) 276 WP_342556671.1 hypothetical protein -
  MKY76_RS12855 (MKY76_12855) - 2564119..2564394 (-) 276 WP_205443823.1 helix-turn-helix transcriptional regulator -
  MKY76_RS12860 (MKY76_12860) - 2564530..2564838 (-) 309 WP_342556672.1 hypothetical protein -
  MKY76_RS12865 (MKY76_12865) - 2564835..2565572 (-) 738 WP_342556673.1 ORF6C domain-containing protein -
  MKY76_RS12870 (MKY76_12870) - 2565659..2565883 (-) 225 WP_312126315.1 helix-turn-helix transcriptional regulator -
  MKY76_RS12875 (MKY76_12875) - 2566050..2566412 (+) 363 WP_342556674.1 helix-turn-helix transcriptional regulator -
  MKY76_RS12880 (MKY76_12880) - 2566886..2567944 (+) 1059 WP_342556675.1 DUF4236 domain-containing protein -
  MKY76_RS12885 (MKY76_12885) - 2567941..2568552 (+) 612 WP_342556676.1 excalibur calcium-binding domain-containing protein -
  MKY76_RS12890 (MKY76_12890) - 2569108..2570322 (+) 1215 WP_342556677.1 hypothetical protein -
  MKY76_RS12895 (MKY76_12895) - 2570267..2570788 (+) 522 WP_342556678.1 hypothetical protein -
  MKY76_RS12900 (MKY76_12900) - 2570806..2571387 (+) 582 WP_342556679.1 hypothetical protein -
  MKY76_RS12905 (MKY76_12905) - 2571481..2571981 (+) 501 WP_342556680.1 ImmA/IrrE family metallo-endopeptidase -
  MKY76_RS12910 (MKY76_12910) - 2572118..2573287 (+) 1170 WP_342556681.1 tyrosine-type recombinase/integrase -
  MKY76_RS12915 (MKY76_12915) - 2574239..2574481 (+) 243 WP_342556682.1 hypothetical protein -
  MKY76_RS12920 (MKY76_12920) - 2574850..2575440 (-) 591 WP_342556683.1 DUF4355 domain-containing protein -
  MKY76_RS12925 (MKY76_12925) - 2575698..2576216 (-) 519 WP_313869755.1 hypothetical protein -
  MKY76_RS12930 (MKY76_12930) - 2576329..2576691 (-) 363 WP_232540661.1 hypothetical protein -
  MKY76_RS12935 (MKY76_12935) - 2577229..2577507 (-) 279 WP_313869758.1 hypothetical protein -
  MKY76_RS12940 (MKY76_12940) - 2577512..2577820 (-) 309 WP_326140931.1 hypothetical protein -

Sequence

Protein


Download         Length: 194 a.a.        Molecular weight: 21613.60 Da        Isoelectric Point: 5.2149

>NTDB_id=984052 MKY76_RS12820 WP_342556666.1 2560310..2560894(-) (ssbA) [Lysinibacillus sp. FSL P4-0201]
MINRVVLVGRLTKDPELRYTPNGIASCRFTVAINRTFANQNGERDADFINCQAWRKAAENLANYQRKGALIGLEGRIQTH
SYEDQNGQRVYITTVVADSIQFLESRSQASGQQQPNPYPSQQQQPQYGGQAYGNNQPTYNGGQPQQQFGGAMPGQGAYQQ
NQSPMNQSSYTRVDEDPFANSRGPIEVSDDDLPF

Nucleotide


Download         Length: 585 bp        

>NTDB_id=984052 MKY76_RS12820 WP_342556666.1 2560310..2560894(-) (ssbA) [Lysinibacillus sp. FSL P4-0201]
ATGATTAATCGTGTCGTATTAGTTGGCCGTCTTACAAAAGATCCTGAGTTACGCTACACACCGAACGGGATTGCATCTTG
CCGCTTTACAGTAGCCATTAACCGTACATTTGCCAATCAAAATGGTGAGCGTGATGCAGATTTTATTAACTGCCAAGCAT
GGCGGAAAGCAGCTGAAAATCTAGCAAACTATCAGCGCAAAGGGGCACTGATTGGTTTAGAAGGTCGTATTCAAACGCAT
AGTTACGAGGATCAGAATGGACAAAGAGTATATATCACTACTGTTGTAGCAGACAGTATCCAATTTTTAGAGTCACGTAG
TCAAGCTAGTGGACAACAGCAGCCTAATCCATATCCATCGCAACAACAGCAGCCTCAATATGGCGGACAAGCTTACGGCA
ACAACCAGCCAACATATAATGGTGGACAGCCGCAACAGCAATTCGGTGGTGCTATGCCAGGGCAAGGTGCTTATCAGCAA
AATCAATCGCCTATGAATCAATCTAGCTATACAAGAGTAGATGAGGACCCATTTGCGAATAGTCGAGGACCGATAGAAGT
GTCTGACGATGATTTGCCATTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

48.969

100

0.49
  ssb Latilactobacillus sakei subsp. sakei 23K

46.392

100

0.464

Multiple sequence alignment