Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   NST76_RS22215 Genome accession   NZ_CP151994
Coordinates   4544011..4544583 (-) Length   190 a.a.
NCBI ID   WP_058844074.1    Uniprot ID   -
Organism   Lysinibacillus sp. FSL W7-1291     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4506181..4553269 4544011..4544583 within 0


Gene organization within MGE regions


Location: 4506181..4553269
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST76_RS22020 (NST76_22020) - 4506181..4506720 (-) 540 WP_101966857.1 VUT family protein -
  NST76_RS22025 (NST76_22025) queE 4506762..4507490 (-) 729 WP_342535197.1 7-carboxy-7-deazaguanine synthase QueE -
  NST76_RS22030 (NST76_22030) queD 4507483..4507956 (-) 474 WP_342535198.1 6-carboxytetrahydropterin synthase QueD -
  NST76_RS22035 (NST76_22035) queC 4507960..4508619 (-) 660 WP_342544455.1 7-cyano-7-deazaguanine synthase QueC -
  NST76_RS22040 (NST76_22040) queF 4508739..4509239 (-) 501 WP_004233404.1 preQ(1) synthase -
  NST76_RS22045 (NST76_22045) - 4509622..4510533 (-) 912 WP_342544456.1 restriction endonuclease -
  NST76_RS22050 (NST76_22050) - 4510624..4510851 (+) 228 WP_205446271.1 hypothetical protein -
  NST76_RS22055 (NST76_22055) - 4510986..4511591 (-) 606 WP_342544457.1 hypothetical protein -
  NST76_RS22060 (NST76_22060) - 4511696..4511965 (-) 270 WP_205446273.1 Mor transcription activator family protein -
  NST76_RS22065 (NST76_22065) - 4512100..4513740 (-) 1641 WP_342544459.1 recombinase family protein -
  NST76_RS22070 (NST76_22070) - 4514106..4514951 (-) 846 WP_342544462.1 tyrosine-type recombinase/integrase -
  NST76_RS22075 (NST76_22075) - 4514995..4516824 (-) 1830 WP_342544463.1 DUF927 domain-containing protein -
  NST76_RS22080 (NST76_22080) - 4516901..4517422 (-) 522 WP_342544466.1 hypothetical protein -
  NST76_RS22085 (NST76_22085) - 4518678..4518950 (-) 273 WP_342544467.1 hypothetical protein -
  NST76_RS22090 (NST76_22090) - 4518947..4519249 (-) 303 WP_342544468.1 hypothetical protein -
  NST76_RS22095 (NST76_22095) - 4519332..4519787 (-) 456 WP_342544469.1 JAB domain-containing protein -
  NST76_RS22100 (NST76_22100) - 4519849..4520370 (-) 522 WP_342544470.1 DUF1643 domain-containing protein -
  NST76_RS22105 (NST76_22105) - 4520792..4521568 (+) 777 WP_342544471.1 MspI family type II restriction endonuclease -
  NST76_RS22110 (NST76_22110) - 4521616..4523007 (-) 1392 WP_342544472.1 DNA cytosine methyltransferase -
  NST76_RS22115 (NST76_22115) mauJ 4523239..4524009 (+) 771 WP_342544474.1 methylamine utilization protein MauJ -
  NST76_RS22120 (NST76_22120) rlmH 4524113..4524592 (-) 480 WP_036119387.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -
  NST76_RS22125 (NST76_22125) - 4524683..4524847 (-) 165 WP_082673719.1 CxxH/CxxC protein -
  NST76_RS22130 (NST76_22130) - 4525092..4526390 (-) 1299 WP_036119381.1 trypsin-like peptidase domain-containing protein -
  NST76_RS22135 (NST76_22135) - 4526557..4527345 (-) 789 WP_036119378.1 MBL fold metallo-hydrolase -
  NST76_RS22140 (NST76_22140) yycI 4527345..4528166 (-) 822 WP_036119375.1 two-component system regulatory protein YycI -
  NST76_RS22145 (NST76_22145) yycH 4528153..4529478 (-) 1326 WP_342535218.1 two-component system activity regulator YycH -
  NST76_RS22150 (NST76_22150) walK 4529475..4531340 (-) 1866 WP_058844079.1 cell wall metabolism sensor histidine kinase WalK -
  NST76_RS22155 (NST76_22155) yycF 4531346..4532059 (-) 714 WP_036077923.1 response regulator YycF -
  NST76_RS22160 (NST76_22160) - 4532274..4533737 (-) 1464 WP_058844077.1 M23 family metallopeptidase -
  NST76_RS22165 (NST76_22165) - 4534141..4535004 (+) 864 WP_051891596.1 YitT family protein -
  NST76_RS22170 (NST76_22170) - 4535054..4536343 (-) 1290 WP_036119360.1 adenylosuccinate synthase -
  NST76_RS22175 (NST76_22175) dnaB 4536580..4537941 (-) 1362 WP_036119357.1 replicative DNA helicase -
  NST76_RS22180 (NST76_22180) rplI 4537955..4538401 (-) 447 WP_036119355.1 50S ribosomal protein L9 -
  NST76_RS22185 (NST76_22185) - 4538401..4540371 (-) 1971 WP_036119352.1 DHH family phosphoesterase -
  NST76_RS22190 (NST76_22190) - 4540385..4541326 (-) 942 WP_342544475.1 YybS family protein -
  NST76_RS22195 (NST76_22195) rpsR 4541644..4541850 (-) 207 Protein_4284 30S ribosomal protein S18 -
  NST76_RS22200 (NST76_22200) - 4542219..4542917 (+) 699 WP_342544476.1 hypothetical protein -
  NST76_RS22205 (NST76_22205) - 4542927..4543124 (+) 198 WP_036119346.1 hypothetical protein -
  NST76_RS22210 (NST76_22210) rpsR 4543735..4543971 (-) 237 WP_004233359.1 30S ribosomal protein S18 -
  NST76_RS22215 (NST76_22215) ssbA 4544011..4544583 (-) 573 WP_058844074.1 single-stranded DNA-binding protein Machinery gene
  NST76_RS22220 (NST76_22220) rpsF 4544627..4544914 (-) 288 WP_036119511.1 30S ribosomal protein S6 -
  NST76_RS22225 (NST76_22225) - 4545081..4545656 (+) 576 WP_271911976.1 DUF3267 domain-containing protein -
  NST76_RS22230 (NST76_22230) - 4545712..4546752 (-) 1041 WP_036119516.1 acyl-CoA dehydrogenase -
  NST76_RS22235 (NST76_22235) ychF 4546837..4547937 (-) 1101 WP_036119519.1 redox-regulated ATPase YchF -
  NST76_RS22240 (NST76_22240) - 4548037..4548237 (-) 201 WP_036119522.1 DUF951 domain-containing protein -
  NST76_RS22245 (NST76_22245) - 4548237..4549109 (-) 873 WP_036119525.1 mechanosensitive ion channel family protein -
  NST76_RS22250 (NST76_22250) yyaC 4549201..4549833 (+) 633 WP_338652191.1 spore protease YyaC -
  NST76_RS22255 (NST76_22255) - 4549750..4550466 (-) 717 WP_036119532.1 DUF554 domain-containing protein -
  NST76_RS22260 (NST76_22260) - 4550544..4551392 (-) 849 WP_036119535.1 ParB/RepB/Spo0J family partition protein -
  NST76_RS22265 (NST76_22265) - 4551385..4552146 (-) 762 WP_036119537.1 AAA family ATPase -
  NST76_RS22270 (NST76_22270) noc 4552367..4553269 (-) 903 WP_036119540.1 nucleoid occlusion protein -

Sequence

Protein


Download         Length: 190 a.a.        Molecular weight: 20619.61 Da        Isoelectric Point: 4.7719

>NTDB_id=984030 NST76_RS22215 WP_058844074.1 4544011..4544583(-) (ssbA) [Lysinibacillus sp. FSL W7-1291]
MINRVVLVGRLTKDPELRYTPNGIASTRFTVAVNRAFSNQQGEREADFISCVAWRKQAENLANFMRKGSLIGVEGRIQTG
SYEGQDGKRVYTTDVVADSVQFLEPRNGSGAPAPQYGGGQTYGNNQPSYGGGQPQQQFGGGAMPGQGSYGGDAYQQNQPP
MNQPNYTRVDEDPFANSKGPIEVSEDDLPF

Nucleotide


Download         Length: 573 bp        

>NTDB_id=984030 NST76_RS22215 WP_058844074.1 4544011..4544583(-) (ssbA) [Lysinibacillus sp. FSL W7-1291]
ATGATAAACCGTGTCGTATTAGTCGGAAGACTAACAAAAGATCCTGAGCTACGTTATACACCAAATGGAATTGCGTCTAC
AAGATTTACAGTTGCTGTAAACCGTGCATTCTCAAATCAACAAGGTGAACGCGAAGCTGATTTCATTAGCTGTGTTGCAT
GGCGAAAACAGGCTGAAAACCTAGCGAACTTCATGCGAAAAGGAAGTTTAATTGGGGTAGAAGGCCGTATTCAAACAGGC
AGTTATGAAGGACAAGACGGTAAGCGAGTATACACAACAGATGTCGTGGCAGATAGCGTACAGTTTTTAGAACCCCGTAA
TGGTAGCGGTGCACCTGCTCCTCAATACGGTGGTGGACAAACTTACGGTAATAACCAACCGTCATATGGCGGTGGTCAAC
CACAACAACAGTTTGGTGGCGGCGCAATGCCAGGACAGGGTTCCTATGGCGGCGATGCTTATCAGCAAAATCAACCACCT
ATGAATCAGCCGAATTATACACGTGTAGATGAGGACCCATTTGCGAATAGCAAAGGGCCAATAGAAGTATCTGAGGATGA
TCTTCCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

54.211

100

0.542
  ssb Latilactobacillus sakei subsp. sakei 23K

47.368

100

0.474

Multiple sequence alignment