Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NST15_RS14770 Genome accession   NZ_CP151991
Coordinates   2838093..2838233 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL R5-0820     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2833093..2843233
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST15_RS14745 (NST15_14745) - 2833372..2833761 (-) 390 WP_008345855.1 hotdog fold thioesterase -
  NST15_RS14750 (NST15_14750) comA 2833785..2834426 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  NST15_RS14755 (NST15_14755) comP 2834507..2836819 (-) 2313 WP_035701206.1 ATP-binding protein Regulator
  NST15_RS14760 (NST15_14760) comX 2836860..2837030 (-) 171 WP_074041927.1 competence pheromone ComX -
  NST15_RS14765 (NST15_14765) - 2837027..2837941 (-) 915 WP_342498609.1 polyprenyl synthetase family protein -
  NST15_RS14770 (NST15_14770) degQ 2838093..2838233 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NST15_RS14775 (NST15_14775) - 2838739..2839092 (+) 354 WP_017358939.1 hypothetical protein -
  NST15_RS14780 (NST15_14780) - 2839129..2840355 (-) 1227 WP_035701209.1 HDOD domain-containing protein -
  NST15_RS14785 (NST15_14785) - 2840495..2841964 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  NST15_RS14790 (NST15_14790) - 2841982..2842533 (-) 552 WP_025207909.1 isochorismatase family cysteine hydrolase -
  NST15_RS14795 (NST15_14795) - 2842594..2843001 (-) 408 WP_046344389.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=983879 NST15_RS14770 WP_003213123.1 2838093..2838233(-) (degQ) [Bacillus sp. FSL R5-0820]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=983879 NST15_RS14770 WP_003213123.1 2838093..2838233(-) (degQ) [Bacillus sp. FSL R5-0820]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment