Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NST09_RS14875 Genome accession   NZ_CP151988
Coordinates   2859507..2859647 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL W7-1346     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2854507..2864647
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST09_RS14850 (NST09_14850) - 2854829..2855218 (-) 390 WP_008345855.1 hotdog fold thioesterase -
  NST09_RS14855 (NST09_14855) comA 2855242..2855883 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  NST09_RS14860 (NST09_14860) comP 2855964..2858270 (-) 2307 WP_035389261.1 ATP-binding protein Regulator
  NST09_RS14865 (NST09_14865) comX 2858284..2858454 (-) 171 WP_017358941.1 competence pheromone ComX -
  NST09_RS14870 (NST09_14870) - 2858432..2859355 (-) 924 WP_017367962.1 polyprenyl synthetase family protein -
  NST09_RS14875 (NST09_14875) degQ 2859507..2859647 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NST09_RS14880 (NST09_14880) - 2860153..2860506 (+) 354 WP_019744042.1 hypothetical protein -
  NST09_RS14885 (NST09_14885) - 2860543..2861769 (-) 1227 WP_017358938.1 HDOD domain-containing protein -
  NST09_RS14890 (NST09_14890) - 2861910..2863379 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  NST09_RS14895 (NST09_14895) - 2863397..2863948 (-) 552 WP_008345872.1 isochorismatase family cysteine hydrolase -
  NST09_RS14900 (NST09_14900) - 2864009..2864416 (-) 408 WP_007500468.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=983695 NST09_RS14875 WP_003213123.1 2859507..2859647(-) (degQ) [Bacillus sp. FSL W7-1346]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=983695 NST09_RS14875 WP_003213123.1 2859507..2859647(-) (degQ) [Bacillus sp. FSL W7-1346]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment