Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSQ34_RS14510 Genome accession   NZ_CP151984
Coordinates   2808283..2808423 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL P2-0069     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2803283..2813423
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ34_RS14485 (NSQ34_14485) - 2803549..2803938 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  NSQ34_RS14490 (NSQ34_14490) comA 2803962..2804603 (-) 642 WP_034282566.1 response regulator transcription factor Regulator
  NSQ34_RS14495 (NSQ34_14495) comP 2804684..2806996 (-) 2313 WP_034282568.1 ATP-binding protein Regulator
  NSQ34_RS14500 (NSQ34_14500) comX 2807050..2807220 (-) 171 WP_073207246.1 competence pheromone ComX -
  NSQ34_RS14505 (NSQ34_14505) - 2807217..2808131 (-) 915 WP_176967247.1 polyprenyl synthetase family protein -
  NSQ34_RS14510 (NSQ34_14510) degQ 2808283..2808423 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NSQ34_RS14515 (NSQ34_14515) - 2808929..2809285 (+) 357 WP_041115816.1 hypothetical protein -
  NSQ34_RS14520 (NSQ34_14520) - 2809321..2810547 (-) 1227 WP_176967282.1 HDOD domain-containing protein -
  NSQ34_RS14525 (NSQ34_14525) - 2810685..2812157 (-) 1473 WP_041115814.1 nicotinate phosphoribosyltransferase -
  NSQ34_RS14530 (NSQ34_14530) - 2812175..2812726 (-) 552 WP_024425949.1 isochorismatase family cysteine hydrolase -
  NSQ34_RS14535 (NSQ34_14535) - 2812787..2813194 (-) 408 WP_034282575.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=983450 NSQ34_RS14510 WP_003213123.1 2808283..2808423(-) (degQ) [Bacillus sp. FSL P2-0069]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=983450 NSQ34_RS14510 WP_003213123.1 2808283..2808423(-) (degQ) [Bacillus sp. FSL P2-0069]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment