Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NST65_RS14770 Genome accession   NZ_CP151983
Coordinates   2849477..2849617 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL P4-0248     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2844477..2854617
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST65_RS14745 (NST65_14745) - 2844811..2845200 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  NST65_RS14750 (NST65_14750) comA 2845224..2845865 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  NST65_RS14755 (NST65_14755) comP 2845946..2848237 (-) 2292 WP_065215229.1 ATP-binding protein Regulator
  NST65_RS14760 (NST65_14760) comX 2848251..2848424 (-) 174 WP_046313343.1 competence pheromone ComX -
  NST65_RS14765 (NST65_14765) - 2848402..2849325 (-) 924 WP_065215228.1 polyprenyl synthetase family protein -
  NST65_RS14770 (NST65_14770) degQ 2849477..2849617 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NST65_RS14775 (NST65_14775) - 2850123..2850479 (+) 357 WP_041115816.1 hypothetical protein -
  NST65_RS14780 (NST65_14780) - 2850515..2851741 (-) 1227 WP_024423326.1 HDOD domain-containing protein -
  NST65_RS14785 (NST65_14785) - 2851879..2853351 (-) 1473 WP_046313339.1 nicotinate phosphoribosyltransferase -
  NST65_RS14790 (NST65_14790) - 2853369..2853920 (-) 552 WP_024425949.1 isochorismatase family cysteine hydrolase -
  NST65_RS14795 (NST65_14795) - 2853981..2854388 (-) 408 WP_034282575.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=983388 NST65_RS14770 WP_003213123.1 2849477..2849617(-) (degQ) [Bacillus sp. FSL P4-0248]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=983388 NST65_RS14770 WP_003213123.1 2849477..2849617(-) (degQ) [Bacillus sp. FSL P4-0248]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696


Multiple sequence alignment