Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHI30_RS17000 Genome accession   NZ_CP151961
Coordinates   3321048..3321188 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus sp. FSL L8-0528     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3316048..3326188
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHI30_RS16975 (MHI30_16975) - 3316339..3316728 (-) 390 WP_075751278.1 hotdog fold thioesterase -
  MHI30_RS16980 (MHI30_16980) comA 3316745..3317383 (-) 639 WP_075751279.1 response regulator transcription factor Regulator
  MHI30_RS16985 (MHI30_16985) comP 3317470..3319785 (-) 2316 WP_075751280.1 sensor histidine kinase Regulator
  MHI30_RS16990 (MHI30_16990) comX 3319806..3319976 (-) 171 WP_075751281.1 competence pheromone ComX -
  MHI30_RS16995 (MHI30_16995) - 3319960..3320859 (-) 900 WP_075751282.1 polyprenyl synthetase family protein -
  MHI30_RS17000 (MHI30_17000) degQ 3321048..3321188 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  MHI30_RS17005 (MHI30_17005) - 3321674..3322021 (+) 348 WP_256700590.1 hypothetical protein -
  MHI30_RS17010 (MHI30_17010) - 3322063..3323283 (-) 1221 WP_075751284.1 HDOD domain-containing protein -
  MHI30_RS17015 (MHI30_17015) - 3323458..3324927 (-) 1470 WP_023856157.1 nicotinate phosphoribosyltransferase -
  MHI30_RS17020 (MHI30_17020) - 3324945..3325496 (-) 552 WP_026580053.1 isochorismatase family cysteine hydrolase -
  MHI30_RS17025 (MHI30_17025) - 3325679..3326080 (-) 402 WP_075751285.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=982280 MHI30_RS17000 WP_003184860.1 3321048..3321188(-) (degQ) [Bacillus sp. FSL L8-0528]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=982280 MHI30_RS17000 WP_003184860.1 3321048..3321188(-) (degQ) [Bacillus sp. FSL L8-0528]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTTGAAAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment