Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ACNM7T_RS12010 Genome accession   NZ_CP183041
Coordinates   2484361..2484675 (-) Length   104 a.a.
NCBI ID   WP_012117982.1    Uniprot ID   A7Z6N6
Organism   Bacillus amyloliquefaciens strain Scm     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2479361..2489675
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNM7T_RS11965 (ACNM7T_11965) sinI 2480043..2480216 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACNM7T_RS11970 (ACNM7T_11970) sinR 2480250..2480585 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACNM7T_RS11975 (ACNM7T_11975) tasA 2480633..2481418 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACNM7T_RS11980 (ACNM7T_11980) sipW 2481483..2482067 (-) 585 WP_015240205.1 signal peptidase I SipW -
  ACNM7T_RS11985 (ACNM7T_11985) tapA 2482039..2482710 (-) 672 WP_124934997.1 amyloid fiber anchoring/assembly protein TapA -
  ACNM7T_RS11990 (ACNM7T_11990) - 2482969..2483298 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACNM7T_RS11995 (ACNM7T_11995) - 2483338..2483517 (-) 180 WP_003153093.1 YqzE family protein -
  ACNM7T_RS12000 (ACNM7T_12000) comGG 2483574..2483951 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACNM7T_RS12005 (ACNM7T_12005) comGF 2483952..2484452 (-) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  ACNM7T_RS12010 (ACNM7T_12010) comGE 2484361..2484675 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACNM7T_RS12015 (ACNM7T_12015) comGD 2484659..2485096 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACNM7T_RS12020 (ACNM7T_12020) comGC 2485086..2485394 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACNM7T_RS12025 (ACNM7T_12025) comGB 2485399..2486436 (-) 1038 WP_094031834.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACNM7T_RS12030 (ACNM7T_12030) comGA 2486423..2487493 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACNM7T_RS12035 (ACNM7T_12035) - 2487687..2488637 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11904.90 Da        Isoelectric Point: 6.9470

>NTDB_id=981587 ACNM7T_RS12010 WP_012117982.1 2484361..2484675(-) (comGE) [Bacillus amyloliquefaciens strain Scm]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCTADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=981587 ACNM7T_RS12010 WP_012117982.1 2484361..2484675(-) (comGE) [Bacillus amyloliquefaciens strain Scm]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTACGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6N6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

42.609

100

0.471


Multiple sequence alignment