Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACNM7T_RS11965 | Genome accession | NZ_CP183041 |
| Coordinates | 2480043..2480216 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain Scm | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2475043..2485216
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACNM7T_RS11950 (ACNM7T_11950) | gcvT | 2475856..2476956 (-) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACNM7T_RS11955 (ACNM7T_11955) | - | 2477380..2479050 (+) | 1671 | WP_124934996.1 | DEAD/DEAH box helicase | - |
| ACNM7T_RS11960 (ACNM7T_11960) | - | 2479072..2479866 (+) | 795 | WP_076424968.1 | YqhG family protein | - |
| ACNM7T_RS11965 (ACNM7T_11965) | sinI | 2480043..2480216 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACNM7T_RS11970 (ACNM7T_11970) | sinR | 2480250..2480585 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACNM7T_RS11975 (ACNM7T_11975) | tasA | 2480633..2481418 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACNM7T_RS11980 (ACNM7T_11980) | sipW | 2481483..2482067 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| ACNM7T_RS11985 (ACNM7T_11985) | tapA | 2482039..2482710 (-) | 672 | WP_124934997.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACNM7T_RS11990 (ACNM7T_11990) | - | 2482969..2483298 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ACNM7T_RS11995 (ACNM7T_11995) | - | 2483338..2483517 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACNM7T_RS12000 (ACNM7T_12000) | comGG | 2483574..2483951 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACNM7T_RS12005 (ACNM7T_12005) | comGF | 2483952..2484452 (-) | 501 | WP_257899725.1 | competence type IV pilus minor pilin ComGF | - |
| ACNM7T_RS12010 (ACNM7T_12010) | comGE | 2484361..2484675 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACNM7T_RS12015 (ACNM7T_12015) | comGD | 2484659..2485096 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=981584 ACNM7T_RS11965 WP_003153105.1 2480043..2480216(+) (sinI) [Bacillus amyloliquefaciens strain Scm]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=981584 ACNM7T_RS11965 WP_003153105.1 2480043..2480216(+) (sinI) [Bacillus amyloliquefaciens strain Scm]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |